KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM164350Help
Entry
Phum_PHUM164350   CDS       T01223                                 

Definition
(RefSeq) palmitoyl-protein thioesterase, putative
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00062  Fatty acid elongation
phu01100  Metabolic pathways
phu01212  Fatty acid metabolism
phu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Phum_PHUM164350
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Phum_PHUM164350
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Phum_PHUM164350
Lipid biosynthesis proteins [BR:phu01004]
 Fatty acid synthase
  Component type
   Phum_PHUM164350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Abhydrolase_1 PGAP1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 8236605
NCBI-ProteinID: XP_002424951
VectorBase: PHUM164350
UniProt: E0VFQ7
AA seq 290 aa AA seqDB search
MKFFFTDFILICFFLFIFIENCLCYKPVFIIHGILSKNVSMKILEKRIKQLHPSTIVSSC
DRYDDIGSLEPMWIQVEKIGEDLLDFSSKYPDGIHLIGYSQGGLIARGILQKYPNHNVKT
FISLSSPQAGQYGTQFLHILFPGVVKEEAYKLFYTNAGQWIAVGNYWNDPHKQDLYYNYS
IFLPVINNEVPSKRDPNYKEGLTNLEKMILIGGPEDEIITPWQSSVFGYYNDNETVEMMQ
DRTLYKDDYCGLKTLDENNKLKVFIVDGVRHLAWRKNQTVIDNYIIPYLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttttttacggattttattttaatttgtttttttttatttatttttattgaa
aattgtttatgttacaaaccagtttttattattcatggaatattaagtaaaaatgtcagt
atgaaaatattagaaaaacgcattaaacagcttcatccatctacaatagtttcttcatgt
gatcgttatgatgacattggtagtttggaaccaatgtggattcaagttgaaaaaattgga
gaagatttattagatttttcttcaaaatatccagatggaatacatttaattggttattcc
caaggaggacttatagccagaggaatattacaaaaatatccaaatcacaatgttaaaaca
tttatttctttgagttctccacaagctggacaatatggaactcagtttttgcacatttta
tttcctggtgttgtgaaagaagaagcttacaaactcttttatacaaatgctggccaatgg
atagcagttggaaattattggaatgatccacacaaacaagatttatattacaattatagt
attttcttaccagttattaataatgaagtacccagtaaaagggatccaaattataaagaa
ggactaacaaacttggaaaaaatgatattgattggtgggcctgaggatgaaatcataaca
ccttggcaatccagtgtgtttggatattataatgacaatgaaacagtggaaatgatgcag
gataggacactttataaggacgattattgcggacttaaaactcttgatgaaaataataaa
ttaaaggtttttattgtagatggagtaagacatttggcatggagaaaaaatcagactgta
attgataattacattatcccttacttagattaa

DBGET integrated database retrieval system