KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM171820
Entry
Phum_PHUM171820   CDS       T01223                                 
Name
(RefSeq) hypothetical protein
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00230  Purine metabolism
phu00730  Thiamine metabolism
phu01100  Metabolic pathways
phu01232  Nucleotide metabolism
phu01240  Biosynthesis of cofactors
Module
phu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM171820
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Phum_PHUM171820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM171820
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Phum_PHUM171820
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM171820
SSDB
Motif
Pfam: Dpy-30 ADK Hydin_ADK AAA_17 AAA_18 Zeta_toxin AAA_33 AAA RIIa AAA_16 Mg_chelatase
Other DBs
NCBI-GeneID: 8236728
NCBI-ProteinID: XP_002425073
VectorBase: PHUM171820
UniProt: E0VG29
AA seq 893 aa
MVLEDDEEEDEEMRSEYSNVDNDFDGTMDDKNDDELYPESEEKRPTSKYYRSDEYEVIGS
LNFLKNPDYKRPEGIIEILDNENKSEYLEKILMCGVIVYDITNDLYCHPSQIEEAKWVAE
CRIFLIFNEKTQPKFFAKYQDCRTFILVSTLLTWAKTKPIDPDDPSLPFTERDFRKRKPH
SNYKIHCQLEKRITELGKKYPKNFRTVVIGAGIPYGHEEDILHIYFKMAWLNSPHLPIFG
SGKNILPVIHIDSLSSIIRNIIDDFPEKMSYIVAMDPQTITLNEVAKLLAKNLGNGKVLK
VNKEEAFLYNEVEQKIFDMLTANINIYPNYIMNKENIVWGTDRPFNENIKKLIEEYKIAR
GLLPVKIFMHGPPASGKSFMASRLSKYYDIPHLHVKKIIQDTIQEMKDKIQAIKNKNESV
KEKDDNDENLEEEEDDEEEEEEEEDLDTLVAKLAEIEQNMNSSEKKRLDEEYVIQFFKKK
MMSNACLNKGFVIDGYPKTMEDTKKLYEVDEETQIEKDAADDEEQIDVSALSNALILPEY
VESLDASDEYLINRVIKMPEKSVLNSHYEEAEMCRRLSQFRALNTEDNTPLIYYDELEIH
PMIYDIENDTDPLMSSTFKAIVNRIGPPRNYNKSVEDIINEQRKFCEDQMKENLRLQKED
IKKKNEEKRENIEQWMLLKNRELEMEEKALLVMGMPLRHYLMKYIFPTLTRGLVEVARLR
PDDPVDFLSEFLFQENPEGKMFQPNFEEREKKLEDALKEYEGYSTSSTTSEPFSSTKTYS
TEKSAKSHAISKVSSYKCSLVSKKSTKSSKSKQSPRSTKSTKSSKSTKSKAGSKTESCTC
AKSPSLSTCSSDIDPPTPTSCSCTLSESYETPEDDEPLKRKGQPGTCKCPCVT
NT seq 2682 nt   +upstreamnt  +downstreamnt
atggtactggaagatgatgaagaagaagatgaagaaatgagaagtgaatactcaaatgta
gataatgattttgatggaacaatggatgataaaaatgatgatgaattatatccggaaagt
gaagaaaagagaccgactagtaaatattatcgaagtgatgaatatgaagttattggaagt
ttaaattttttaaaaaatcccgattataaaagacccgagggaataatagaaatattagat
aatgaaaataaatcggaatatttagaaaaaattcttatgtgcggagtaattgtatacgac
ataacaaatgatttatactgtcatcctagtcaaattgaagaagccaaatgggttgcagaa
tgtaggatatttttaatttttaacgaaaaaacacaaccgaaattttttgccaaatatcaa
gattgtcgtacatttattctggtatccacattactaacgtgggcaaaaactaaaccgatc
gatcctgatgatccatctctgccgtttaccgaaagagattttcgaaagcgtaaacctcat
tcgaattataaaattcactgtcaattggaaaaaagaataaccgaacttgggaagaagtat
ccgaaaaattttcgtactgttgttatcggtgctggaataccttacggacacgaagaagac
attttacatatatatttcaaaatggcgtggttgaattctccacatttacccattttcggt
tctggaaaaaatattcttcccgtcatacatatcgattcgttaagttcgataattcgaaat
ataattgatgattttcctgaaaaaatgtcttatattgttgcaatggatccccaaactatt
acattaaatgaagtcgctaagcttttagctaaaaatttaggaaatggtaaagtacttaaa
gtcaataaagaagaagcttttttatataatgaagtagagcaaaaaatatttgatatgctt
accgccaatataaatatttatccaaattatattatgaataaagaaaatattgtctggggt
acggatcgtccatttaatgaaaacattaaaaaattaattgaagaatataaaatagctcgt
ggattattgccagtaaaaatatttatgcacggtcctcctgcaagtggaaaatcattcatg
gcttcaagattatccaaatattatgatatccctcatttacacgtgaaaaaaattattcaa
gatacaattcaagaaatgaaagataaaatacaagcgattaaaaataaaaacgaatccgtc
aaagaaaaagatgacaatgatgaaaatttagaagaagaagaagatgatgaagaagaagaa
gaggaagaagaagatttggatacgttagttgcaaagcttgcggaaatagaacaaaatatg
aacagcagtgaaaaaaagagattggatgaagaatatgttattcagttttttaaaaaaaaa
atgatgtccaacgcttgcttaaacaaaggatttgttattgatgggtatccgaaaacgatg
gaagatacgaaaaaactttatgaagttgatgaagaaacccaaattgaaaaagatgctgct
gatgatgaagaacaaattgatgtttctgctttgagtaatgctttgatactaccagaatac
gttgaaagtttggatgcgtctgacgaataccttattaatcgcgttatcaaaatgcctgaa
aaaagcgttttaaattctcattacgaagaagctgaaatgtgtcgtaggttgtcacaattt
agagcgttgaataccgaagataacactccgcttatttattacgacgaattagaaattcat
ccgatgatatacgatatagaaaacgatacggatcctttaatgtcttcaacgttcaaagca
atcgtcaatagaatcggacctcctcgaaattataataaatccgttgaagacattattaac
gaacaaagaaaattttgcgaggatcaaatgaaagaaaatttaagacttcaaaaagaagat
ataaaaaaaaaaaatgaagaaaaaagagaaaatattgaacaatggatgcttttaaaaaat
cgagaattagaaatggaagaaaaagctcttttggttatgggaatgcctcttagacattat
ttaatgaaatatatatttcccactttgactagaggtttggttgaagttgccagactacga
cccgatgaccccgttgattttctttcagaatttttattccaagaaaatcccgaaggtaaa
atgtttcaaccgaatttcgaagaaagagagaaaaaacttgaagatgcacttaaagaatat
gaaggttacagtacgtcatcaaccacttctgaaccatttagtagtacgaaaacttattcg
actgaaaaatcagctaaaagtcacgcaatatcaaaagtgtcaagctacaaatgttcgctg
gtgtctaaaaaatcaacaaaaagctcgaaatctaaacagagtccgagatctacgaaaagt
acaaaatcttctaaaagtacaaaatcgaaagctggttcgaaaactgaatcttgcacttgt
gctaaatctccgagtctttcgacttgttcatcagatattgatcctcctactcccacgtct
tgctcttgtacattatcagagagttacgagacacccgaagacgatgaacctttgaaaaga
aaaggacaaccaggaacttgcaaatgcccttgcgtaacttaa

DBGET integrated database retrieval system