KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM174960Help
Entry
Phum_PHUM174960   CDS       T01223                                 

Definition
(RefSeq) thioredoxin domain-containing protein 4 precursor, putative
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM174960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM174960
Membrane trafficking [BR:phu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Phum_PHUM174960
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM174960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6
Motif
Other DBs
NCBI-GeneID: 8236773
NCBI-ProteinID: XP_002425118
VectorBase: PHUM174960
UniProt: E0VG74
AA seq 351 aa AA seqDB search
MLAPIYDEAAEKVHSEFNQPGRIVMGKVDCDRDSSIASRFHITKYPTLKLFRNGQPAKRE
YRGQRSADAFVEFIKNQLEDPIKEFSHISELNNLDGKKRIVIGYFDKKDVPEYSTFRRVA
TNLKEDCQFYVGFGDASKQMHPPNQPIIVFRPDRDRSNEADETFTGNLNSYDEVNIWMTE
RCVPLVREITFQNAEELTEEGLPFLILFHKPDDLESIKKFNDVVQRELISEKQNINFLTA
DGVKFAHPLHHLGKSVSDLPLIAIDSFRHMYLFPDASQMEIPGKLKTFLKDLYSGKLHRD
FHNKPEFPTLDNRIKSSNEIEKVKAPTTPPESTFKKLAPSKNRYTLLKDEL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctggcacccatttatgatgaagctgcggaaaaagttcattcggaattcaatcaacct
ggtagaattgttatgggaaaagttgattgcgatagagacagctccatagcttccaggttt
cacataacaaaatatccaacactgaaattatttcgtaatggacaaccagcgaaaagagaa
tacagagggcaaagatcggctgatgcttttgtagaatttattaaaaatcaattagaagat
cctataaaagaattttcacacataagtgaattgaataatcttgatgggaaaaaaagaatt
gttatcggttattttgacaaaaaggatgtacctgaatattcgacatttagaagagtagca
acaaatttaaaagaagattgtcaattttatgtaggatttggcgatgcttcgaaacaaatg
catcctcctaatcaaccgataatagtttttcgaccggatagagatcgttcgaatgaagca
gacgaaacatttaccggaaatctgaatagttacgacgaagtaaatatttggatgacggaa
agatgcgttccactcgtgagagaaataacatttcaaaatgccgaagaactgacggaagaa
ggattgccttttttaatattgtttcacaaacctgacgaccttgaaagtattaaaaaattt
aatgatgttgttcagcgagaattaatttcagaaaaacaaaatataaattttttgaccgct
gacggagtcaaatttgctcatccccttcatcatttgggaaaatccgtgagcgatttgcct
ctgatcgcaatcgacagttttaggcacatgtacttgtttccggatgcgagtcaaatggaa
atccccggcaaacttaaaacattcctcaaggatttgtattcagggaaacttcacagagat
tttcacaacaagccagaatttccaacattggacaatcgaatcaaatcatcgaacgaaatt
gaaaaagtcaaagctccaacgacgccacccgaatccacatttaaaaaattagcaccgtct
aaaaatagatatacactattgaaagatgaattataa

DBGET integrated database retrieval system