KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM196800Help
Entry
Phum_PHUM196800   CDS       T01223                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
Module
phu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM196800
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM196800
Protein kinases [BR:phu01001]
 Serine/threonine kinases: STE group
  STE7 family
   Phum_PHUM196800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 8240325
NCBI-ProteinID: XP_002425403
VectorBase: PHUM196800
UniProt: E0VH09
AA seq 372 aa AA seqDB search
MNLNHFNTPPSTLMKDGTIPTNHRQNLPKIVPFNQEILIEMSRERLNLTQTMQSSGRLEV
SPNSVYDFTSDDLQDLGEIGRGAFGTVNKMIHRKSNTVMAVKRIRSTIDEREQKILLMDL
DVVMKSNDCPFIVKFYGALFKEGDCWICMQLMDTSLDKFYKFIYEKLKQRIPENIIGKIT
VATVKALNYLKEELQIIHRDVKPSNILLDKQGNIKLCDFGISGQLVDSIARTRDAGCRPY
MAPERIDPQTAKGYDVRSDVWSLGITLMEVSTGHFPYPKWNTVFEQLNQVVKGDPPRLSP
NEDGITFTMDFVRFVNTCLIKDEDQRPKYNALLQHPFIKKSDEDKVDVALYVSEILNNMT
NNGATQFTMNEP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaatcacttcaatacacctccttctactttaatgaaagatggaaccattcca
actaaccataggcaaaatttacccaaaatagttccatttaatcaagaaattttaatagaa
atgtctcgggaaagattaaatttaactcaaaccatgcaatcatctggtagattagaagta
tcaccaaattcagtttatgattttacttctgacgatcttcaagatttaggtgaaatagga
cgaggagcttttggtactgttaacaaaatgatacacagaaaatcaaatacagtgatggct
gtaaagagaattagatctacaattgatgaaagagagcaaaaaattttgcttatggattta
gatgttgttatgaaatcaaatgattgcccttttattgttaaattttatggtgctttattc
aaagagggggattgttggatatgtatgcaacttatggatacttcattagataaattttat
aaatttatttatgaaaaactaaagcaaagaattccggaaaatattataggaaaaataacc
gttgctactgttaaagctcttaattacttaaaagaagaacttcaaataattcacagagat
gtgaaacctagcaatatattattagataaacaaggaaatatcaaattatgtgattttggt
atatctggacaactggttgattcaattgcaagaacaagagacgctggctgcagaccttac
atggcacctgaaaggatagatccacaaactgctaaaggttatgatgtgagatctgatgtt
tggtcgttaggaattacattaatggaagtgtcaacaggtcattttccatatcctaaatgg
aatacagtgtttgaacaattaaatcaagttgttaaaggtgatccacccaggttatctccc
aatgaagatggaatcacttttacaatggactttgtacgatttgttaatacatgtttaatt
aaagatgaggatcagagacccaaatataatgctcttcttcaacatccttttataaaaaaa
tcagatgaagataaagttgatgtggctctttatgttagtgaaatattaaataatatgacc
aataatggtgctacacaatttacaatgaatgaaccttga

DBGET integrated database retrieval system