KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM203740
Entry
Phum_PHUM203740   CDS       T01223                                 
Name
(RefSeq) hypothetical protein
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00520  Amino sugar and nucleotide sugar metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phum_PHUM203740
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     Phum_PHUM203740
SSDB
Motif
Pfam: Glyco_hydro_18 CBM_14 Porin_O_P SH2_2
Other DBs
NCBI-GeneID: 8238527
NCBI-ProteinID: XP_002425481
VectorBase: PHUM203740
UniProt: E0VH87
AA seq 950 aa
MSVARVRRKLRRPTSSALIKKGDQEISASVNRFRVKNKSSVNSIATRKSSDSSDEQEYKV
VCYYTNWSQYRPKHGKFLPEDIQPDLCTHVIYAFGWLKKGKLSSFESNDETKDGKVGLYD
RIMKLKKSNPNLKILLAIGGWSFGTQKFKDMSSSRYSRQTFIYSAIPYLRDRNFDGLDID
WEYPKGSDDKKNYVFLLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIRSGYDVPAVAS
YLDFINLMAYDFHGKWERETGHNAPLHAPSSDSEWRKQLSVENAAGTWVRLGAPKDKLII
GMPTYGRTFTLSNPKVYKVNSPASGGGKAGEYTKEGGFLAYYEICEMLRKGASYIWDDEM
KVPYLVDGDQWVGFDDEKSIRHKMKWLKSNGFGGAMVWTVDMDDFTGTICGGKVKYPLIG
AMREELLGIPRENNAKDIDWSKVANSIVEVNIEKPEPIKIDVSDLLSKFKKPTKAKTVEN
VITSTNERDPQVFCYMTSWSQKRPGAGKFTPEDVDAGLCTHVVYAFATLKNHKLSEADDK
DGEMYDRVVALREKNPNLKVLLAIGGWAFGSTPFKELTSNTFRMNQFVYEAIEFLREYKF
NGLDVDWEYPRGADDRSSYVNLLKELRLAFEGEAKSSNQPRLLLSAAVPASFEAIAAGYD
VPEISKYLDFINVMTYDFHGQWERQVGHNSPLYSLDSATSYQKKLTVDYSAREWVKQGAP
KEKLMIGMPTYGRSFTLVNESQFDIGAPASGGGTPGKYTGEAGFMSYYEVCDFLQKDNTT
LVWDNEQQVPFAYKEDQWVGFDDERSLKTKMEWLKEEGFGGIMIWSVDMDDFKGHCGTGK
YPLIKSMKSELENYKVKLEYDGPYESSNPNGQYTTKDPNEVVCEEEDGHISYHKDKADCR
MYYMCEGERKHHMPCPANLVFNPNENVCDWPENVEGCMHHTAAPPPSRRR
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgtcggtggcacgtgtcagaagaaaattaagaaggcctacgtcgagcgcattgattaaa
aaaggagatcaagaaatatcggcaagtgtaaatagatttcgtgtgaaaaataaatcgagc
gttaattctattgccacgagaaaatctagcgatagttcagacgaacaagaatacaaggtt
gtttgttattatacaaactggtcgcagtatcgtccgaaacatgggaaatttttaccagaa
gacatacaaccagatctttgcactcacgtcatttacgctttcggatggttgaaaaaggga
aaactttcgtcgttcgaatccaacgacgaaacgaaagatggaaaagtcggattgtacgat
agaataatgaaattgaaaaaatctaatcccaatttgaaaattttacttgccatcggtggt
tggtcattcggaactcaaaaatttaaagacatgtcatcttcgagatattctagacaaact
ttcatatacagcgccataccttatttgagagatagaaatttcgacggtctcgatatcgat
tgggaatatccaaaaggttcagatgataagaaaaattacgtctttttattaaaagaactc
agagaagctttcgaagccgaagcgcaagaagttaaaaaacctagattgttattaaccgct
gccgtacctgtcggtccagacaatataagatccggttacgacgtacctgccgttgccagt
tatttggattttattaatttgatggcatacgatttccacggcaaatgggaaagagaaacg
ggtcacaatgcaccacttcatgctccatcatccgacagcgaatggagaaaacaattatcc
gtcgaaaacgctgctggaacgtgggtacgtttgggagcacccaaagacaaattgatcatc
ggaatgccgacatatggtagaactttcactttatcgaatccaaaagtttataaggtaaac
agtccggcgagcggcggtggtaaagctggagaatacacgaaagaaggaggatttttagct
tattacgagatttgcgaaatgttaagaaaaggagcttcttacatttgggacgatgaaatg
aaagtaccctatctcgtcgatggtgatcaatgggtcggtttcgacgatgaaaaatcaata
agacataaaatgaaatggttaaaatctaacggttttggtggagccatggtttggaccgtt
gacatggacgatttcactggaacaatttgcggtggaaaagttaaatatccactcatagga
gccatgagagaagaattgttgggcataccgagagaaaacaatgctaaagacattgattgg
agtaaagttgctaattcaattgtcgaagttaatatcgaaaaaccggaaccgattaaaatt
gacgtttccgatttgttgagtaaatttaaaaaacctacgaaagctaaaactgttgaaaac
gtcatcacgtccaccaacgaacgagaccctcaagtattctgttacatgacaagttggtcg
caaaaacgtccgggcgctggaaaatttacaccggaagacgtcgacgccggtctttgcacg
cacgtagtttatgcttttgccacgttaaaaaatcacaaattatccgaagcagacgataaa
gatggagaaatgtacgaccgtgttgttgctttaagagaaaagaatccaaatcttaaggtt
cttcttgccatcggaggttgggctttcggttctactccgtttaaagaactcacatcgaac
acgttcagaatgaatcaattcgtatacgaagccattgaatttttaagagaatataaattt
aacggtttagacgtggattgggaatatccaagaggagcagacgatcgttcatcttacgta
aacttattaaaagaattaagattggcattcgaaggtgaagctaaaagttcaaatcaaccg
agattacttttatcagctgctgtaccagctagtttcgaagccattgctgccggttacgac
gttccagaaatttctaaatatttagatttcataaacgtcatgacttatgatttccacggt
caatgggaaagacaagtcggtcataattctccactttattcattggacagcgcaacgagc
tatcaaaaaaaactcaccgtcgattacagcgctagagaatgggtgaaacaaggggctcca
aaggaaaaactcatgatcggtatgccgacgtacggtagatctttcactcttgtcaatgaa
agtcaatttgatatcggtgctccggcttccggtggtggtactcctggtaaatatacggga
gaagctggatttatgagctattacgaagtttgcgatttcttgcaaaaagataacacgacg
ttggtttgggacaatgaacaacaagtacctttcgcttacaaagaagatcaatgggtcggt
ttcgacgacgaaagaagtttaaaaactaagatggaatggttaaaggaagaaggtttcggt
ggtataatgatatggtctgtcgacatggacgattttaagggtcattgcggaaccggaaaa
tacccattgataaaatccatgaaatccgaactcgaaaattacaaagttaaactcgaatac
gacggaccgtacgaaagctcgaaccctaacggacaatacacgaccaaagatccaaatgaa
gttgtttgcgaagaagaagacggtcacataagttaccacaaagacaaagcagattgtaga
atgtattacatgtgcgagggagaaagaaaacatcacatgccatgtccagctaatttagta
tttaatccaaacgaaaacgtttgcgattggccggaaaacgttgaaggatgcatgcaccac
acagcagccccgccaccaagtagaagacgataa

DBGET integrated database retrieval system