KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM234540
Entry
Phum_PHUM234540   CDS       T01223                                 
Name
(RefSeq) STIP1 homology and u box-containing protein, putative
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04120  Ubiquitin mediated proteolysis
phu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Phum_PHUM234540
   04120 Ubiquitin mediated proteolysis
    Phum_PHUM234540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:phu03110]
    Phum_PHUM234540
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM234540
   04121 Ubiquitin system [BR:phu04121]
    Phum_PHUM234540
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     Phum_PHUM234540
Chaperones and folding catalysts [BR:phu03110]
 Other chaperones and cochaperones
  Others
   Phum_PHUM234540
Membrane trafficking [BR:phu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Phum_PHUM234540
Ubiquitin system [BR:phu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   Phum_PHUM234540
SSDB
Motif
Pfam: U-box CHIP_TPR_N TPR_2 TPR_1 TPR_11 TPR_8 TPR_16 ANAPC3 TPR_12 TPR_14 zf-NOSIP TPR_7 TPR_17 TPR_9 NRBF2_MIT
Other DBs
NCBI-GeneID: 8230192
NCBI-ProteinID: XP_002426063
VectorBase: PHUM234540
UniProt: E0VIW9
AA seq 287 aa
MSKYTYSTANLTDKELKEQGNRLYSLRKYEDAINCYTKAIIKNPNMPTYFTNRALCYLKM
KKWEASCLDCKRALDIDSGLVKGHFFLGQALLEMDSHDEAIKHLQRAYDLAKEQKLNFGD
DIGSQLRAARKKRWNVQEEKRIAQEIELQSYLNKLIRDDTINQIQKLKLECTNELELQEK
IMECERRCDNNTSELNMLFAKVDERRRKRDVPDFLCGKISFEVLREPVITPSGITYERKD
IEEHLQRVGHFDPVTRVKLTQDQLIPNFAMKEVVDSFLQENEWALDY
NT seq 864 nt   +upstreamnt  +downstreamnt
atgagcaaatacacgtattctacggctaatctgacggataaagaacttaaagaacaagga
aatcgcctttatagcttaaggaaatatgaagatgcaattaattgttatacgaaagcaatt
attaaaaatccaaacatgcctacttattttacaaatagagctctttgctacttgaaaatg
aaaaaatgggaagcatcttgcctggattgtaaaagagctttagacattgactcaggttta
gttaagggacatttttttctcggtcaggcacttttagaaatggatagtcacgatgaagct
atcaaacatttgcaaagagcctatgatttagctaaagagcaaaagttaaattttggagat
gatatcggtagtcaattaagagcagcaaggaaaaaaagatggaatgttcaggaggaaaag
agaattgcacaagaaattgaattacaatcatatttaaataaattgattagagatgataca
attaatcaaattcaaaaattaaaattagaatgtaccaacgaattggaattgcaagaaaaa
ataatggagtgtgaaaggcgttgtgataacaacacttcagaattaaacatgttgtttgcc
aaagttgatgaacgacgtcgaaaacgagatgtcccagatttcctttgtggtaaaataagt
tttgaagtattaagagaacctgtaattactcctagcggtataacttatgagagaaaagac
atagaagaacacttacaaagggtcggtcatttcgatccggttactcgtgttaaattaact
caagatcaattaattccgaattttgccatgaaagaagttgtagatagttttcttcaagag
aatgaatgggctttggattattaa

DBGET integrated database retrieval system