KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM249390Help
Entry
Phum_PHUM249390   CDS       T01223                                 

Definition
(RefSeq) Replication protein A 32 kDa subunit, putative
  KO
K10739  replication factor A2
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03030  DNA replication
phu03420  Nucleotide excision repair
phu03430  Mismatch repair
phu03440  Homologous recombination
phu03460  Fanconi anemia pathway
Module
phu_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:phu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Phum_PHUM249390
   03420 Nucleotide excision repair
    Phum_PHUM249390
   03430 Mismatch repair
    Phum_PHUM249390
   03440 Homologous recombination
    Phum_PHUM249390
   03460 Fanconi anemia pathway
    Phum_PHUM249390
DNA replication proteins [BR:phu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Phum_PHUM249390
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Phum_PHUM249390
   MMR (mismatch exicision repair)
     Phum_PHUM249390
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Phum_PHUM249390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon MogR_DNAbind
Motif
Other DBs
NCBI-GeneID: 8238810
NCBI-ProteinID: XP_002426363
VectorBase: PHUM249390
UniProt: E0VJR9
AA seq 208 aa AA seqDB search
MDQWSDNRGGYFVGNEPTTPNQSVSSAIRQQFLCPVTVRQVLEAPEQGLKVGSLTATMVS
LCGVVSNVEITSTTIKFSLTDDTGIIDCLEWLETQDNSKISKTTNLLENNYYHVYGCVKY
PQGSRRIMVFKTVKVTDFNEITAFMLEVLSTNEYAEKTTKDSKVPATNAFGQNSFTSFNI
STDDRNKLTPIQKAIMDAISGGQDMNQG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatggagtgataatagaggaggatattttgtgggaaatgagcccactactcct
aaccaatctgtatcttcagctatcagacaacaatttttgtgtcctgttactgtcaggcaa
gttttagaagctcctgagcaaggtttaaaagtaggatccttgacagctactatggtatca
ctttgtggagtagttagtaatgttgaaataacatcaacgactataaaatttagtttaact
gatgacacaggaataatcgattgtttagaatggctggaaactcaggataacagtaaaata
tctaaaactacaaatcttttagaaaataattattatcatgtttatggttgtgttaaatat
ccccaaggaagtagaagaataatggtgtttaaaacagtcaaagttactgattttaatgaa
ataactgcatttatgttagaagttttaagtaccaatgaatatgctgaaaaaacaaccaag
gattctaaagtaccagccacaaatgcatttggtcaaaattcattcacttcatttaatatt
tccactgatgatagaaacaaactaacaccaattcaaaaagcaattatggatgccataagt
ggtggtcaagatatgaatcagggttaa

DBGET integrated database retrieval system