KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM252380
Entry
Phum_PHUM252380   CDS       T01223                                 
Name
(RefSeq) ornithine carbamoyltransferase, putative
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00220  Arginine biosynthesis
phu01100  Metabolic pathways
phu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Phum_PHUM252380
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Phum_PHUM252380
SSDB
Motif
Pfam: OTCace_N OTCace
Other DBs
NCBI-GeneID: 8235069
NCBI-ProteinID: XP_002426415
VectorBase: PHUM252380
UniProt: E0VJX1
AA seq 338 aa
MSLLKNSNLTPFVKKSWRNFRTQTTLHNFIKPETISADYWKKLLSTAFHLKEVVRKNNKN
CLNLLKNKHVTLLFEHPHGRFQVAFSLACSILGARKTLYLERDFESQPNPADCGRYVLLS
ELSDMLVVHGIPQWSLLKLGEFTTIPIFPASCNIYSLQKVLSDFMTFQEIFNKLEGLTIA
YVGPPTPVFNSYLLLCPLFGIKIQYLCICVYGSGLMSPVKKSLKKNLKSKFIQERNSVRE
TVKNSNVIVTTLHPERATQITLDILKEASSNWIFLHSLPRSESEVHDDVFHHKNNMSWTS
SENHLYIAMLKRKKKKKGREPNYFIAKSITEPKVLTWF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtcgttattaaaaaattccaatttgacgccatttgtaaaaaaaagttggcgaaatttt
aggactcaaaccacgttgcataattttatcaagccggaaaccatttcagctgactattgg
aaaaaattattatcaacggcattccatttgaaagaagtcgtacgtaaaaataataaaaac
tgtttaaatttattgaaaaataaacatgtaacgttattgttcgaacatcctcatggaaga
tttcaagttgctttttcactggcttgttcaatattgggtgctagaaaaacattatattta
gaaagagattttgaaagtcaaccaaatccagcagattgtggaaggtatgtattattatca
gagttgtcagacatgctcgtagtacacggtatacctcaatggtcattattaaaacttggt
gaattcacaacgattccaatatttccagccagttgtaacatatacagtcttcaaaaagta
ttaagcgattttatgacgtttcaagaaatttttaataaactcgagggattaacgatagca
tatgttggtccacccacgccagtatttaattcttatttacttttatgcccactttttgga
ataaaaattcagtatctttgtatttgcgtttatggttctggactaatgtcacccgttaaa
aaatcactaaagaaaaatttaaaatcaaaatttatacaagaacgtaattccgttagggaa
actgttaaaaattctaacgtaattgttaccacattacatccggaaagagcaactcaaatt
acattggatatattaaaagaagcatcatcgaattggatatttttacattctttaccgaga
agcgaatcagaagtacacgatgatgttttccatcataaaaataacatgtcgtggacttca
tcagaaaatcatttatacatagctatgttaaaacgaaaaaaaaaaaaaaaaggtcgagaa
ccgaattattttattgcaaaatcgataactgaaccaaaagttttaacttggttttaa

DBGET integrated database retrieval system