KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM278190Help
Entry
Phum_PHUM278190   CDS       T01223                                 

Definition
(RefSeq) Exportin-5, putative
  KO
K14289  exportin-5
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Phum_PHUM278190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phu03016]
    Phum_PHUM278190
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM278190
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    Phum_PHUM278190
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     Phum_PHUM278190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 8239017
NCBI-ProteinID: XP_002426807
VectorBase: PHUM278190
UniProt: E0VL13
AA seq 1202 aa AA seqDB search
MATPEMIDQITGELIRALEITMNPVAEQSARQEAYTAYENFKDNSPYAPQVGLYLVQLNT
PHGYIVHFGLQLMEHCVKFRWNQISQPEKIFIKENTMRLLMDGKQKETYVKDGLSRIIVE
MIKREWPQQWPSLLTELNVASLQGPTQSEIVLLIFLRLCEDVAVLQTLESTQRRRDIYQA
LTTNMQDIFSFLIQIITCHIDLFKSIGNLEAGNQHFRVVQTGLTTLSSFLEWASYTHFTN
NDNALLKILCALLEDEHFQINAVDCLLQVVSRKGNPEEKKFFIEWFDLKVLQFMLDAANK
VSTKSLNENNYLFLKKLIQVLTGLGTYFTALCGKEDFVSFTRSEYLNTYLNIMLTFFRHP
SLTIISYTISTWSSFFKNPVISQDPVFKKYIPELFETAAPKIIRVFYPTSRNPINDQDTT
ALLDFDSEEEFNAFFFKTRTDLLEIFRKATDIAPFVTFSYVEKWFRSVLQKSVIQLSSDK
TNFCTYTSPLYLQWDGLVNTLDRVLNRLVHIESHSRPSVFSGLELLELCLNFNPLDPLIL
SELLSCISALFVFLSMATAEQSVSILPRVLDKIFAASVFLLPGQTIENRSRAVKNVRRHA
GALLVKIGQRYPLLLLPLFDQINTTVQAIIRDPQLSKMEQVTIQEALLLICNHFYDYNKQ
SQFVGELMKPGIDMWFEMENAFRSASDFMALVGLDKPPVEPSQEDINGKNRSHLLFCLHL
FFSVLLRSTWPEDPDRAARGGFVVDRTSTGNPIYRNPATPHIIPILPNVLSLVKVLNALW
APDTLSRISEGYKDAFQMSENEKANLLSLVPQSNVQSDQLDAGIKVQSPLDRMQQFLETV
HSNSYLFLGTIGPSLGKDFYQIPQLGLALINSLFSNLEFVPDFKLRAVIRTFFKSFIPSC
PKVCYKDVLLPVLSIFMPYMLTRLTKKWEHISQLRQESTNSEESSDAQEVVDEKLTHIIT
KEYSDVINICLVGGNSDSVLDSDAMEQDDLTESSGQRNVNQAFAETVSELGLMLIRNEST
QHVIIITLLRFISWSDGCAIYKAPVLLHCVLRQLSNDGILNEEIANHVMTTVLQALQIQG
HQEAMQGLLLTLGAQLYELLRPKFPSIVKILMQIPNVNQQDLQKFDEKIILSSQNFKTSY
KLDKSTKDLFKKITHPLIGRNISQLFKKEIKIMDLPKLNLPKKGTKEKVDFNYGQELNKL
LS
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atggctactccagaaatgattgaccaaataacaggagagcttattagagcattagaaatt
actatgaatcctgtcgcagaacaatctgctagacaggaagcatatactgcatatgaaaat
tttaaggataattctccttatgcaccccaagttggtttgtatttagttcaactaaacact
cctcatgggtacattgtgcattttggtttacaactaatggagcattgcgttaaattcaga
tggaatcaaatatcgcaacctgaaaaaatctttattaaggaaaacacaatgaggctcttg
atggatggaaaacaaaaagaaacatatgtaaaagatggtctttctagaataattgttgaa
atgattaaaagggaatggccacagcaatggccttcattattgactgaactaaatgttgct
agtttacaaggaccaactcaatctgaaattgttttgttaatttttttaagactgtgtgaa
gatgttgcagttttacaaactttagaatctactcaaagaagaagagatatttatcaagct
ttaactaccaacatgcaagatatattttcttttttaatacaaataattacttgccatatt
gatttatttaaatcaatcggaaacttagaggctgggaatcagcattttagagttgttcaa
actggtttgacaactttatccagtttcttagaatgggcaagttatacacatttcacaaat
aatgataatgctttacttaaaatactttgtgctcttttagaagatgagcattttcaaatt
aatgctgtcgattgtttacttcaagtcgtttcaaggaaaggaaatcctgaagaaaaaaaa
ttttttatcgaatggttcgatcttaaagttcttcaatttatgttggatgctgccaataaa
gttagcacaaaaagtttaaacgaaaacaattatttatttttaaaaaaacttattcaggta
ttaactggattaggaacttattttactgcattatgcggaaaagaagattttgtttcattt
actcgttcagaatatttaaatacttaccttaatataatgctgacattttttcgacatcca
agtttaaccatcatcagttacacaatttcaacttggtctagtttttttaaaaatccagtc
ataagtcaagatcctgtttttaaaaagtatattccagaattattcgagactgctgctccg
aaaataataagggtattttacccaacttctagaaatccaattaatgatcaggacactacg
gctcttcttgatttcgacagtgaggaagaatttaatgctttttttttcaaaaccagaact
gatcttttagaaatatttagaaaagcaacggatattgcaccttttgttactttttcatat
gtggaaaaatggtttcgatctgttttgcaaaaatctgtcattcaactttcttctgataaa
acaaatttttgtacatacacatctcctttatatttgcaatgggatggattagttaatacg
ttggatcgggttttaaatcgtttagtacatattgaaagtcattcacgaccgagcgttttc
tctggtttggaactcttggaactttgtttaaatttcaatccactggatccccttatattg
tctgaattattatcttgcatatctgcattatttgtttttctttctatggcaacggcagaa
caaagcgttagcattttacctagggttttagataaaatttttgctgcatccgttttctta
ctaccgggacaaacgattgaaaatcgttctcgggcggtgaaaaacgtgagaaggcacgcg
ggtgctttattagtcaaaatcggtcagaggtatccgcttttattattaccattgtttgat
caaataaataccacggttcaagcaatcattagggatccacaactctccaagatggaacaa
gtaaccattcaagaagcacttcttctcatatgtaatcatttttacgattacaataaacaa
tctcaatttgttggggaactcatgaaacccgggatagatatgtggtttgaaatggagaat
gctttcagatcggcttctgattttatggctttggtcggtctggataaacctccggtagag
cctagtcaagaagatataaatgggaaaaatcgatctcacctactgttttgtcttcattta
tttttttcggttttgctcaggagtacgtggcctgaagatccagatcgtgctgctaggggt
ggatttgtcgtcgatagaacaagcaccggaaatccgatatacagaaatcctgcgacgcca
catattataccaattttaccaaatgttttgtctttggtcaaagttttgaatgcattatgg
gcacctgatactttgtcgcgtatatccgagggttataaagatgcttttcaaatgtcggaa
aatgaaaaggctaatcttttgagtttggttcctcaaagcaacgttcaatcggatcaactg
gacgcgggaattaaagttcaaagtccattggatagaatgcaacaatttttagaaaccgta
cattcgaattcgtacctttttttaggaaccatcggtccgagtttaggaaaagatttttat
caaatccctcaattgggactagctttaataaatagtttgttcagtaatttagagtttgtt
cccgattttaaattgagagccgtgataagaacattttttaaaagttttataccgtcgtgt
ccgaaagtgtgttacaaagacgtcctacttcccgttctcagtatttttatgccttacatg
ctaaccaggttaacaaaaaaatgggaacacatttcgcaattacgacaggaatctacgaat
tcggaagaaagttccgatgcacaggaagtggtagatgaaaagctcactcacattatcaca
aaagaatattccgacgtgataaacatatgcttggtcggtggaaatagcgacagcgtttta
gacagtgatgccatggaacaggatgacttgacggaatcctcgggtcaaagaaacgtaaat
caagcttttgcggaaaccgttagcgagttgggtttgatgctcattcgaaatgaaagtact
caacacgtaattatcatcactctcttaagatttatttcttggagtgacggttgtgctatt
tacaaagctcccgttttacttcattgcgttttacgtcaactttcaaacgatggaatttta
aacgaagaaattgcaaatcacgtcatgacgaccgttttgcaagctttgcaaattcaaggt
catcaggaagccatgcaaggattgttattgactttaggtgctcaactttacgaattactc
agaccgaaatttccctcaatagtcaagatattaatgcaaattccaaatgtgaatcaacag
gatttacaaaaatttgatgagaaaataattttatcaagtcaaaatttcaaaacgagttac
aaattagataaatcaacgaaagatctttttaaaaagattacacatccgctcattgggcga
aatatcagtcagttgtttaaaaaagaaattaaaataatggatttgccaaaattaaattta
ccaaaaaaaggaactaaagaaaaagtggattttaattacggtcaggaattaaataaattg
ctgtcataa

DBGET integrated database retrieval system