KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM287330Help
Entry
Phum_PHUM287330   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K06091  MAGUK p55 subfamily member 5
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Phum_PHUM287330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin SH3_2 PDZ SH3_1 PDZ_2 SH3_9 L27
Motif
Other DBs
NCBI-GeneID: 8229579
NCBI-ProteinID: XP_002426955
VectorBase: PHUM287330
UniProt: E0VLG1
AA seq 751 aa AA seqDB search
MMMTMLDNGPHRELPVDVPDSFIAISKTPPRYPPPRTQGSSRMNGLAKPIPPPRDHLTIE
KDGRLMNRLPAPQVPARTVMTINNNTQREPTKREMDSIRKFEEQIRQRKEEEERIAKQNE
FLKSSIRSSKKLQAVESNPPLTGVINDAYSDEEGKDDVAATDIVHKFILYGELVAALQRL
QHQIKENNAPCLGNLEPQLATVQAILLSPQFGRALSVCNKVREVTLSNEKQCLPSPQSWQ
AQELARDCIQILEPCSLPEAGELNQILTSYGMEGLLSAHDTIASGDIVALDAPATDVLLT
SEDAHYISKESTGIKIVNIDKTNEPLGATVRNEGEAVIIGRIVKGGAADKSGLLHEGDEV
LQVNGVDMRGKTIHDVCDILSGMIGTLTFLIIPGHTPRPIQPTNTNTVMHMKAHFDYDPE
DDTYIPCKELGISFQKGDVLHVISQEDPNWWQAYREGEEDQVLAGLIPSRTFQHQRESLK
QQIAGDKLSKEKTKKSSTLLCAKKHNKKKRKKSSCNAYNEGSYPIYSSTLDDYDADEILT
YEEVSLYYPRSNHKRPIVLIGPPNIGRHELRQRLMEDSERFAAAIPHTSRARKESEVDGQ
DYHFTSRAQFESDILARKFVEHGEYEKAYYGTSLDAIRTVVSSGKICVLNLHPQSLKILR
SSDLKPYVVFVAPPSLEKLRQKKIRNGEAYKEDELKGIIEKAREMEDKYGHFFDMIIINN
DTERTYLQLLKEINSLEREPQWVPASWVKAV
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacaatgctagacaatggtccacatagagagcttcccgtggatgtacccgat
tcttttattgccattagcaaaacaccaccaagatatccaccgccaagaactcagggttca
tcacgcatgaacggtttggctaaacctattcctccaccgagagatcatttaacaattgaa
aaagatgggagactgatgaataggttaccagctccgcaggttccagcgagaactgttatg
actatcaataacaatactcaaagggaaccaaccaagcgggaaatggatagtattagaaaa
ttcgaggaacaaattaggcaaagaaaagaagaagaggaaaggatagcaaaacaaaatgaa
tttcttaaaagttcaataagaagttcgaaaaagcttcaagctgttgaaagtaatcctcct
ctaaccggagttattaacgatgcctattcagacgaggaaggaaaagatgatgttgctgcg
actgatattgttcataaatttatactgtacggagaattagtcgccgctttgcaaagactt
caacatcaaataaaagaaaataatgcgccttgtttgggaaaccttgagcctcagttggca
acagtacaagcaattttgttaagtccacaatttggacgagctctttccgtttgtaataaa
gtccgagaagtaactttgtcaaacgaaaaacaatgtttacctagtccgcagtcttggcaa
gctcaagaattggctagagattgcattcaaattctcgaaccgtgctctttaccagaagct
ggcgaattaaatcaaatattaactagttatggtatggaaggattattatctgctcacgat
acaattgcctcgggtgatattgttgccttggatgctcctgccacagatgtacttttaaca
tctgaagatgctcattacatttctaaagaatctacgggcattaaaattgttaatattgac
aaaacgaatgagccactcggtgcgactgttagaaacgaaggagaagctgtaattattggt
agaatagttaaaggaggagcagctgataaatccggtctcttacacgaaggagacgaagtt
ttacaagtaaacggagtagatatgagagggaaaactatacatgatgtctgtgatatattg
tctggaatgataggaactttgacttttctcatcattcccggacacacacctaggcccatt
cagcctacaaacacgaacactgtcatgcacatgaaagctcattttgattacgatccggaa
gatgatacttacataccgtgcaaagaattaggtatcagttttcaaaagggagatgttctt
catgttatttctcaagaagatcccaattggtggcaggcgtatagggaaggagaagaagat
caagtattagcaggattgatacccagtagaacttttcaacatcagagagagtctctcaag
caacaaatagctggagacaaattatcaaaggaaaaaaccaaaaaatcatcaacattatta
tgtgccaaaaaacacaataaaaagaaaaggaaaaaatcgtcatgcaatgcttacaatgaa
ggaagttatccaatttattccagtactttagacgattacgacgcggatgaaatattaaca
tacgaagaagtgtctctatattaccccagatcaaatcacaaacgcccaatagtattaata
ggacctccaaacataggaagacacgaattaaggcagaggttaatggaagattccgaaaga
tttgctgctgctattcctcatacgtcgagagcaagaaaagaatcagaagttgacggtcaa
gattatcattttacatctcgagcacaatttgagtctgatatattagctagaaaattcgtg
gaacatggagaatacgaaaaagcttattacggtacatcgttagacgctataagaactgtt
gtgagttctggtaaaatctgcgtattaaatctacatcctcaaagtttaaaaatattaagg
agttcggatttgaaaccttatgtcgtttttgtcgcgccgccatctctcgaaaaactaagg
cagaagaaaataaggaatggcgaagcgtataaagaggatgaattgaaaggtataattgaa
aaagcaagagaaatggaagataaatacggacattttttcgacatgataataataaataac
gatacggaaagaacgtacttacagttattaaaagaaataaatagtttagaacgtgagcca
caatgggtaccagcatcctgggtcaaggctgtttga

DBGET integrated database retrieval system