KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM288600
Entry
Phum_PHUM288600   CDS       T01223                                 
Name
(RefSeq) male sterility domain-containing protein, putative
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    Phum_PHUM288600
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Phum_PHUM288600
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     Phum_PHUM288600
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind KR
Other DBs
NCBI-GeneID: 8229615
NCBI-ProteinID: XP_002426991
VectorBase: PHUM288600
UniProt: E0VLJ7
AA seq 522 aa
MATLAQQNFTPNFSPVADFYHDRSVFVTGGTGFMGKVLVEKLLRSCPGIKKIYLLIRPKR
GQDIHARLGEIIDSPLFDKLRKERPAELHKIVPIMGDITEPELGISQSDQNLLIKTVSVV
FHSAATVKFDEALKLSVTINMLGTKRLVELCHRMLGLEALIHVSTAYCNCDRGEVREIIY
PPPYDPEKVIECVEWMNEDLVDVITPKLIGKRPNTYTFTKALAENMLMKESGNLPVAIVR
PTIVLSSWNEPVSGWVDNWNGPTGLVAACGKGLFRAMLCEVNSVADLVPVDVVINLMIVA
AWKTATSKSIEVSVYNCCTGMQKPITWGSFIYQCIHNLQKNPLSGAFWYPGGDCFSNRLM
HKLVVLSSHAFPAYFLDTFYRLVGKKPIMVKMYQKLEKARQCLEYFGNQEWRFRDDNVQE
LNSILSPEDRKTFPFDVSQIDWPKYLQDYVLGIRRFIFKENPSSIPTARKSIQKLYWIHR
LVQICSLMFVLRGVIMRSSQARRLCLFVIDVFLRVYRMIPKF
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcgactctcgcacagcaaaattttaccccaaattttagtcccgtcgctgatttttat
cacgaccgttccgtgttcgtcacgggtggaacgggattcatgggaaaagttctcgttgaa
aaattgctcaggtcttgtccaggtataaagaaaatatatcttttgatcaggccgaaaaga
ggtcaagatatacatgctcgattgggagaaataattgattcaccgttatttgataaactc
cgtaaagaacgtccggcagaacttcataaaatagtacccataatgggagatataacggaa
cctgaattaggtatttctcaatccgatcaaaatcttctcataaaaacggtatcggtcgtt
tttcattctgccgccacggttaaattcgacgaagctctcaaactttccgtcacgatcaac
atgttgggaactaaaagattggtagaactgtgtcacagaatgttaggcctcgaggctctc
atacacgtttctacggcgtattgtaattgcgacaggggagaagtgagagaaatcatttat
cctcctccgtacgatccggaaaaagtcatagaatgcgtcgaatggatgaacgaggatttg
gtcgacgtcatcactccaaaactcatcggaaaaagacccaacacgtacacgttcacgaaa
gcgttggcagaaaacatgttgatgaaggaaagtggcaatttacctgttgccatcgtccga
cctacgatagttttatcttcttggaacgaacccgtttccggatgggtcgacaactggaac
ggaccgactggactcgtggcagcttgcggtaagggtttgtttagagcgatgctctgcgaa
gtgaacagcgtcgcggatttagttcccgttgacgttgttatcaatttgatgatcgtcgca
gcctggaaaactgccacttcaaaatctatagaagtaagtgtttacaattgttgtaccggc
atgcaaaaaccgataacgtggggatctttcatttaccaatgcattcacaatcttcaaaaa
aatcccctgagcggtgctttctggtatccgggaggagattgtttcagtaatagattgatg
cacaaactcgtcgttttgtcatcacacgcttttccagcttattttctagatacgttttat
aggcttgtgggaaaaaaaccaataatggttaaaatgtatcagaaattagaaaaggcgaga
cagtgtttagaatatttcggtaatcaagaatggagatttagagatgacaacgttcaagaa
ttgaattcgattttgtcgccggaagataggaaaacgtttccgttcgacgtgagtcaaatc
gattggcccaagtatcttcaagattacgttttaggaatccgaagattcatattcaaagaa
aatccttcgtcgattccaacggcaaggaaaagcatacaaaagttgtattggattcatcga
ttagttcaaatttgtagcctcatgttcgtattaagaggtgttataatgagatcgtcacag
gctcgacgactttgtttattcgttatcgatgttttcctacgcgtctatagaatgattcca
aaattttag

DBGET integrated database retrieval system