KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM291280
Entry
Phum_PHUM291280   CDS       T01223                                 
Name
(RefSeq) 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, putative
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00561  Glycerolipid metabolism
phu00564  Glycerophospholipid metabolism
phu01100  Metabolic pathways
Module
phu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Phum_PHUM291280
   00564 Glycerophospholipid metabolism
    Phum_PHUM291280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:phu01004]
    Phum_PHUM291280
Enzymes [BR:phu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Phum_PHUM291280
Lipid biosynthesis proteins [BR:phu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Phum_PHUM291280
SSDB
Motif
Pfam: Acyltransferase SRF-TF
Other DBs
NCBI-GeneID: 8229666
NCBI-ProteinID: XP_002427037
VectorBase: PHUM291280
UniProt: E0VLP3
AA seq 296 aa
MAFLDLSQLWNYGFYALIVFILILPFLYDGGRQAVTYHGKFFFYYFLVSLSAIGFSFVFC
FNAKNVKNCWYAADALKNIGKLFGIKWELRGMEHIIKDGAIVIANHQSSLDLLGMFQFWR
IMGKVTAIAKKELFYFWPFGLCAWLAGVVFIDRNNASKSYDILKESAKLTKEDETKLFFF
PEGTRNIKVNKTKTLLPFKKGAFKLAILCQIPILPVVFSPYYFIDSDDKYFKTGKVIVKA
LPPISTTDLTEKDIGDLMEKARNAMTKAFEELFDEVVCSLPENHKMRSSMQKMRTE
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcttttttagatttatcgcaattatggaattatggattttatgcattgattgttttt
atattgatccttccttttttatacgatggaggaaggcaagctgttacttatcatgggaaa
tttttcttttattattttctagtatcattatctgcaataggttttagttttgttttttgt
ttcaatgcgaaaaatgttaaaaattgttggtacgcagctgatgctcttaaaaacattggc
aaactttttggaatcaaatgggaattgagaggtatggaacatataattaaagatggtgcc
attgtcattgcaaaccatcaatcttcattggatttgttaggaatgtttcaattttggaga
atcatgggaaaagtaacggctatagcaaaaaaagaattattttatttttggccttttgga
ttgtgcgcttggcttgccggtgttgttttcatagatcgtaataacgcttcgaaatcttac
gacatattaaaagaatcggctaaattaacaaaagaagatgagaccaaattgttttttttt
cccgaaggtacgagaaatataaaagtcaataaaacgaaaactttgttaccatttaaaaaa
ggagcttttaaattagccattttatgtcagatacccattttacccgttgttttctcccct
tattatttcattgattccgatgataaatattttaaaacgggaaaagtcatagtgaaagca
ttacccccaatatcgacgacggatctcacggaaaaagacatcggggatctaatggaaaaa
gcgagaaacgccatgacgaaagctttcgaagaattattcgacgaagttgtttgttcccta
ccggaaaatcataaaatgcgttcatcaatgcaaaagatgaggacggaataa

DBGET integrated database retrieval system