KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM299460Help
Entry
Phum_PHUM299460   CDS       T01223                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Phum_PHUM299460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:phu03041]
    Phum_PHUM299460
Enzymes [BR:phu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Phum_PHUM299460
Spliceosome [BR:phu03041]
 Complex C
  Other components
   Step II factors
    Phum_PHUM299460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 T2SSE AAA_19 AAA_30 Flavi_DEAD AAA_16
Motif
Other DBs
NCBI-GeneID: 8229792
NCBI-ProteinID: XP_002427158
VectorBase: PHUM299460
UniProt: E0VM14
AA seq 1236 aa AA seqDB search
MDELQKLEHLSLVSKICTELENHLGINDKDLAEFIIALSEKNNTFESFKAILLKNGAEFS
DSFIENLLRLIKHMQPKDKPKLEKTVKDVLAEKFPAFTEDQSNDVNEAMAVLESLAPSNI
AKMAEINNLSRDEKLIKNENTKLGDNRENKDVSPAKSLSPERKHKRKDRESTKDDKSNYK
KTKIRNRSRSRSRSRSRKLKHDRYSHQDKDYKRRRSRSHSRSLHRKKRSSLERRKMSRSP
SYDRKKFQRNFYSKDENVRNQTHRGRSKTPEKDLPCDPEVGKIYNGKIANIVPFGCFVQL
ENLRKRWEGLVHISQLRREGRITTVADVVSRGQKVKVKVLSVTGQKVSLSIKDVDQDTGK
DLNPITQGLREQEEEIAHRNPDRPISLLELQRNHDEEEGESRKRVHRISSPEKWELKQMI
SASCINRSELPDFDEETGLLPREEDEEEDIEIELVEDEPPFLQGHGRMLHDLSPVRIVKN
PDGSLAQAAMMQSALSKERREQKMLQREQEMDSMPQTLNKNWIDPLPEADTKTVTANMRG
VGVISQDLPEWKKHVIGGKKSSFGKKTNMTLLEQRESLPIFKLKDDLIKAVTDNQILIVI
GETGSGKTTQITQYLAESGFTFRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIR
FEDCTSPETVIKYMTDGMLLRECLVDLDLKNYSVVMLDEAHERTIHTDVLFGLLKQAVRK
RPELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQI
HLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEP
APPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQFQSKQR
AGRAGRTGPGKCYRLYVERAYRDEMLPTPVPEIQRTNLATTVSFKKLKTMGINDLLHFDF
MDAPPVESLIMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVHLGCSDEI
LTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHLTLLAVYNSWKNNKFSNAWCYEN
FVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKCVCSGFFRNAAKKDPQEGYR
TLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPAFFKFSD
PTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacttcaaaaattagagcatctgtctttagtttcaaaaatatgcacagaatta
gaaaaccatcttggtataaatgataaggatttagctgaatttataattgcattgtcagaa
aaaaacaatacttttgaaagtttcaaagcaatccttttaaaaaatggagcagaattttct
gattcatttatagaaaatttacttcgtttaatcaaacacatgcaaccaaaagataaacca
aaattggaaaaaacagtgaaagatgttttggcagaaaagtttcctgcttttactgaagat
caatctaatgatgtaaatgaagcaatggctgtattagaatctctggcgccatcaaatatt
gctaagatggcagaaatcaacaatttatcaagagatgaaaaacttattaaaaatgaaaat
acaaaacttggtgacaatagggaaaataaagatgtttctcctgctaagagtcttagccca
gaacggaaacataaaagaaaagatagggaatcaacaaaagatgacaaaagtaattataaa
aaaactaaaattagaaatagaagtcgaagcaggagcagaagtagaagtagaaaactaaaa
catgatagatattctcatcaagacaaagactacaagaggagaagatccagatctcattct
agaagcttgcatagaaaaaaaagatctagtcttgaaagaaggaaaatgtctagatcacca
agttatgacagaaaaaaatttcaaagaaatttttactctaaagatgaaaatgttagaaat
caaactcatagaggtagatctaaaactccggaaaaagatttaccttgtgatccagaagtt
ggaaaaatttataatggaaaaatagctaatatagttccttttggctgttttgtacaatta
gaaaatttaagaaaaaggtgggagggattagttcacatatctcagttaagaagagaggga
agaataactacagttgctgatgtcgtatctcgtggtcaaaaagtaaaggttaaggttctt
tcagtaaccggacaaaaagtttcactgtcgattaaagatgttgatcaagatacaggaaaa
gatttaaatccaatcacacaaggccttagagagcaagaggaagaaattgctcacagaaat
ccagatagacctatatctttattagaactgcaaagaaatcatgatgaggaagaaggagaa
agtagaaaaagagttcatagaatatcttcacctgaaaaatgggaattaaagcaaatgatt
tctgcatcctgtataaacaggagtgaattaccagatttcgatgaggaaaccggtttactt
ccaagggaagaagatgaagaagaagatatagaaattgaattggtagaagatgagcctcct
tttttgcaaggacacggtcgaatgcttcacgatttgagtcctgttagaatagttaaaaat
cctgatggtagtcttgctcaagctgcaatgatgcaaagtgcattatcaaaagaaagaagg
gaacaaaaaatgttacaaagagaacaagaaatggattcaatgcctcagacattaaataaa
aactggatagatccattaccagaggctgataccaaaacagtgacagccaacatgagagga
gttggagtaatttctcaagatttaccagagtggaaaaaacatgtcattggaggaaagaaa
agttcttttgggaaaaaaacaaacatgacattactcgagcaaagagaaagtctcccaatt
tttaaacttaaagatgatcttattaaggctgtaacagacaatcaaattttaatagtgatt
ggagaaacgggttctgggaaaactactcaaatcacacaatatttagcagagtctggtttt
acgttccgtggtaaaatagggtgcacccaacctcgaagagttgcagctatgagcgtagca
aaacgtgtagctgaagaatttggatgccgtttgggacaagaagtgggctacacaattcgt
ttcgaggattgtaccagtccagaaacagttattaaatacatgacggacggtatgcttctt
agagaatgtcttgtagatttggacttgaaaaattattcagtcgtaatgttagatgaggct
catgaaagaactattcatacggacgttttgttcggtttattaaaacaagctgtgagaaaa
cgtccggaattaaagcttattgtaacttcagccacattagacgcagttaaattttcccag
tattttttcgaggctcctatttttactatacctggaagaacatttccggtagaagtattg
tatacaaaagaaccggaaactgattacttggatgctagtttaattactgttatgcagatt
catcttcgagaacctcctggtgatattttactttttttaactggtcaagaagaaatcgat
actgcttgtgaaattttatacgaaagaatgaaatcgctgggtccggatgtgcccgagctc
attattcttccagtgtattccgctcttccaagcgaaatgcaaaccagaattttcgagcct
gcacctcctggttcacgtaaagtagttattgctacgaatattgctgaaacttctctaact
attgatggaatttattatgttgtcgaccctggattcgttaaacaaaaagtttataattca
aagacaggaatggatagtttagtagtgacccctatatctcagtttcagtccaagcagcgc
gcgggaagagctgggagaactggacctggaaagtgttacagattatatgttgaaagagct
tacagagacgaaatgcttcccactcctgttccagaaattcaaagaacgaatctcgccaca
accgtaagttttaaaaaattaaaaactatgggtataaatgacctacttcatttcgatttt
atggacgctccacccgtagagtctttaattatggctctcgaacaattgcattctttgagc
gctttggatgatgaaggtcttctaactcgattgggtagaagaatggcagaattcccgttg
gaacctaatttatctaaaatgttaattatgtcagttcatttaggatgttcggatgaaatt
ttaaccatcgtttcaatgcttagcgttcaaaatgtattttacagacctaaagataaacaa
gcattagccgatcaaaaaaaagcaaaatttaaccaaatggagggagatcatttaactctt
ttggctgtttacaattcgtggaaaaacaataagttttcaaatgcttggtgctacgaaaac
tttgtacaaattcgaacgttaaaaagagctcaagatgtgcgaaagcaattgttgggtatc
atggacagacataaactggatgtagtttctgctggaaaaaataccgtaagagttcaaaaa
tgtgtttgttcaggtttttttagaaatgcagccaaaaaagatccacaggaaggttataga
accttggtcgatagtcaagttgtttacattcatccttccagtgcattatttaacagacaa
ccggaatgggttatttaccacgagttggttcaaaccacgaaggaatatatgcgggaagtg
acaacgattgatcctaaatggttggttgaatttgccccggcattttttaaattttcagac
ccgactaagctgagtaaatttaaaaagaatcaacgattagaacccttgtataataaatat
gaagaaccgaatgcatggagaatatctcgagttcgcagaaggagaaattaa

DBGET integrated database retrieval system