KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM333140
Entry
Phum_PHUM333140   CDS       T01223                                 
Name
(RefSeq) GMP synthase, putative
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00230  Purine metabolism
phu00983  Drug metabolism - other enzymes
phu01100  Metabolic pathways
phu01232  Nucleotide metabolism
Module
phu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM333140
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Phum_PHUM333140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phu01002]
    Phum_PHUM333140
Enzymes [BR:phu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Phum_PHUM333140
Peptidases and inhibitors [BR:phu01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   Phum_PHUM333140
SSDB
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase QueC PAPS_reduct tRNA_Me_trans ATP_bind_3 Asn_synthase ThiI Arginosuc_synth GATase_3
Other DBs
NCBI-GeneID: 8239222
NCBI-ProteinID: XP_002427615
VectorBase: PHUM333140
UniProt: E0VNC1
AA seq 685 aa
MHNTSPEGNHRANGAHNGEKIAILDAGAQYGKVIDRRVRELCVESDILPLDTPAFFLKEK
GYKAIIISGGPNSVFAEDAPRYDADIFRIGVPVLGICYGMQMMNKEFGGQIVKKAGREDG
QFNIEVDTKCLLFKSMDKIQPVLLTHGDSIEKVADSFKAVAMSQAFIAGIANDKLRLYGV
QFHPEVELTSNGKTMLKNFLVDIAGLTGNYTMQSREIECINGIKEIVGNNKVLLLVSGGV
DSTVCAALLHKALRPDQVIAVHIDNGFMRKNESALVEESLQRLGLKLKVVNAAQQFFEGT
TKMPGERKPDWKIGQTKMLCQTVNPEEKRKIIGDIFVNVANEVISELNLRPDEVFLGQGT
LRPDLIESASVLASDKAVVIKTHHNDTELVRQLREAGRVVEPLKDFHKDEVRALGRDLGL
PTDLVMRHPFPGPGLAIRVICAEEPYIQRDFSETQVIVKIIVEYEQMLLKKHALLNRVDS
VTSEEERSVLKKVSSSHNLAATLLPIRSVGVQGDNRSYSYVVGISSKNDPVWTDLEFLAK
LIPRICHNINRVCYIAGGLVKDQVQDVTPTFLSSHVLSTLRQVDYIANQVLATSGCMSAI
SQMPVVLIPIHFDRDTALRIPSCQRSVVLRPFCTQDFMTGVPALPGKQLPTEVVNKMMTE
ILTVPGISRVLYDLTPKPPGTTEWE
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcacaacactagtcctgaaggaaaccatcgagcaaatggagctcacaatggtgaaaaa
attgcaattttggatgctggtgctcagtatggaaaggttatagataggagagttagagaa
ttatgtgtggaaagtgatattttacccttggacactccagctttttttttgaaggaaaag
ggatacaaagccattataatatcaggtggacctaattcagtttttgctgaagatgctcct
agatatgatgctgacatctttagaataggtgttccagttttggggatatgctatggaatg
caaatgatgaataaggaatttgggggtcaaattgtaaaaaaagctggtagagaagatgga
caatttaatattgaggtggataccaaatgccttttattcaagagtatggataagattcaa
ccagttcttttaacacatggagatagtatagaaaaagtagcagacagttttaaagctgtt
gctatgtcacaagcatttatcgctggaattgcaaatgataaattaagattatatggtgta
cagtttcatccggaagttgaacttacttctaatgggaaaacaatgctcaaaaacttttta
gtcgatattgcaggcctcactggaaattatacaatgcaaagcagagaaattgaatgcata
aatggcattaaggaaattgttggaaacaataaagttttgctattggttagtggtggtgta
gattcgacagtgtgtgcagctttgcttcacaaagctctcagacctgatcaagtaatagct
gttcatattgataatgggtttatgagaaaaaatgaaagtgcccttgttgaagaatcattg
caaagactgggattaaaattaaaagttgttaatgcagctcaacaatttttcgaaggaaca
accaaaatgcctggagaaagaaaacccgattggaagataggacagacaaaaatgctttgc
caaaccgttaatcccgaagaaaagcgtaaaataattggagacatttttgttaatgtagca
aatgaagtaatttctgaattaaacttaagaccggatgaagtttttttgggccagggtact
cttcggcctgatttaattgaatcggcttcggtgttggcaagtgataaggctgtagttatt
aaaactcatcataatgacacagagttagtcaggcagcttagagaagctggtagagtagtc
gagccccttaaagactttcacaaagatgaagttagagctctgggacgagatttgggtttg
ccgacggatttggttatgcgacatccatttcccggtcctggtttagctattagagtaatt
tgtgccgaagagccttacattcaaagagacttttccgagactcaagttattgttaaaatt
attgtagagtatgagcaaatgcttttaaagaaacatgcacttttgaatagagtagacagc
gtaacaagtgaagaagaaagatcagttttaaaaaaagtttctagtagtcataatttagct
gctacccttttaccaattcgctctgttggtgttcagggcgataatcggagttacagttac
gtagtgggaatatctagtaaaaacgatcccgtttggacagatttggaatttttagctaaa
ctcattcctagaatatgtcacaatataaatagagtttgctacatagccggtggtttagtt
aaagatcaagttcaagatgtaactccgacatttctttcatctcacgtattgagtacttta
agacaagttgattacatagcaaatcaggttttggcaacttccggatgtatgagcgccata
agtcaaatgccggtcgtattaattccaatacattttgatcgtgacaccgcattgcgtatc
ccatcttgtcaaagatccgtcgttcttcggcctttttgtactcaagactttatgacaggt
gttcccgcgttacctggaaaacaactccccacagaggttgtaaataaaatgatgaccgaa
attttaacagtaccgggcatatctagagttctgtacgatttaacaccgaaaccacctgga
acgaccgagtgggagtga

DBGET integrated database retrieval system