KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM344080
Entry
Phum_PHUM344080   CDS       T01223                                 

Name
(RefSeq) ER lumen protein retaining receptor, putative
  KO
K10949  ER lumen protein retaining receptor
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM344080
Membrane trafficking [BR:phu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    Phum_PHUM344080
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 8231858
NCBI-ProteinID: XP_002427772
VectorBase: PHUM344080
UniProt: E0VNS8
AA seq 212 aa
MNIFRLVGDLSHLLAVIILLIKIWKTRSCAGISGKSQLLFAITYTTRYLDLFTTYVSAYN
TVMKVVFIAASYATLYLMYIKFKATYDHNHDTFRIEFLLIPSVVLALLINMEFSVVEILW
TFSIYLESVAILPQLFMVSKTGEAESITSHYLFALGSYRGLYILNWIYRYYAENHYNLIA
IVAGVIQTVLYCDFFYLYITKVLKGKKLQLPA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaatatatttcgacttgtaggtgatctatcacatcttttggctgtgattattttatta
attaaaatatggaaaactcgatcgtgtgcaggcatttcaggaaaatcacagttacttttt
gccataacatacacaactagatatttagatttgtttacaacatatgtttccgcttacaat
actgttatgaaagtagtttttattgctgcatcctatgcaactttatatttgatgtacatt
aaatttaaagcaacatatgatcataatcatgatacattcagaattgagtttttgctgatt
ccatcagtagtattggctttattaattaatatggaattctcagttgtagagatattatgg
acattcagcatttatttagagtcagttgccattttacctcagttatttatggtatctaaa
actggagaagctgaaagtattacttcacattatttgtttgctctcgggtcatatcgtgga
ctttacatccttaattggatatacagatactatgcagaaaatcattacaatcttattgct
attgtagcaggtgttatacaaacagttttgtattgtgactttttctatttatacataaca
aaagttcttaaagggaaaaaattacaactgccagcttag

DBGET integrated database retrieval system