KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM346290
Entry
Phum_PHUM346290   CDS       T01223                                 
Name
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM346290
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:phu03400]
    Phum_PHUM346290
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Phum_PHUM346290
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   Phum_PHUM346290
DNA repair and recombination proteins [BR:phu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    Phum_PHUM346290
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal ABC1 Kdo
Other DBs
NCBI-GeneID: 8231891
NCBI-ProteinID: XP_002427804
VectorBase: PHUM346290
UniProt: E0VNW0
AA seq 469 aa
MSVQFVDGWTIAQVLGEGAFGEVKLLINDETRDVLAVKVINTELHEEAKLAVRKELAIHR
ALNHPNIIRYFGHRSEGTIEYLFLEYASGGELFNKIEPDIGMKLWEAQKYFVQLISGVEY
LHSRGVSHRDIKPENILLDDNDNVKISDFGMATLFRKNGIERLLDKKCGTMPYVAPEVLL
RPYKAAPADVWSCGIVLVAMLAGELPWDVPASTCKEFSLWKNNIITHSPWNKLNNSVLNL
LKKILIPLPDKRLTASQILKHRWCSKIYPNEPVQVNITPASKRLYSGSELAPSMSASEEE
FSRYCFSQPAPQFCDSEGNKGKFEKDDDDLYSNKIVCFSQPVHIDDLLLSSQLHSTQTAA
LDGYQNLIRRMTRFFVTVDAETAIKKVVDVLESSACSWKRGPPFILTFTTIDRRKNNLIF
KTSVVEMNGKVLLDFRLSRGCGLEFKKLFLLVKEKLEDILLKGGVKLKI
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtctgttcaattcgttgacggctggaccattgcacaggtgcttggtgaaggagcgttt
ggagaagtcaagttactaattaatgatgaaactagagatgttttggctgttaaagttatt
aacactgaattgcatgaagaagcaaaattagctgtgagaaaagaactagctatccataga
gctttaaatcatcctaatataattaggtattttggtcatcgcagtgaaggtacaatcgaa
tatttatttctagaatatgcatcaggcggtgaactatttaacaaaatagagcctgacatt
ggtatgaaattatgggaagctcaaaaatattttgtacaattaatatcaggcgttgaatac
cttcattcgagaggggtttctcatcgtgacatcaaacctgaaaatatattattagatgat
aatgataatgttaaaatatcagattttggaatggcaaccttatttagaaaaaacggaatc
gagagacttcttgataagaaatgtggaactatgccttatgtagcccctgaagttcttttg
agaccttataaagctgcgccagctgatgtttggtcttgcggtatagttcttgttgctatg
ctagcgggagaattaccctgggatgttcctgcatccacttgtaaagaattttcattatgg
aaaaataacatcataactcattctccgtggaataaacttaataatagcgttttaaatttg
ttaaaaaaaattttgattccattaccggataaacgtctgacagcaagtcaaatattgaaa
catcgttggtgttctaaaatctaccctaacgaaccagttcaagtaaacatcactcctgca
tcaaaaagactctattctggttcggaactagcaccatcaatgagtgcatccgaagaagaa
ttctcacgttattgtttttctcaacctgctccacagttttgcgacagcgaaggcaacaaa
ggaaaattcgaaaaagatgatgatgatttgtacagtaataaaattgtttgtttctctcaa
cctgttcacattgatgatttacttttaagttcacaacttcattcaacgcaaacggctgct
cttgatggttaccaaaatttaatacgacgaatgaccagattttttgtgactgtggatgct
gaaactgctataaaaaaagttgttgatgtgttggaatcttcggcttgctcctggaaacgc
ggacctccttttatattaacatttaccacaattgatcgtagaaaaaataatttaatattt
aaaactagtgttgtggaaatgaatggaaaagttctattagattttcgtctgtctcgaggt
tgcggattagagtttaaaaaattgtttttgttggtcaaggaaaagttggaagatatttta
ttaaaaggtggggtcaagttgaaaatctaa

DBGET integrated database retrieval system