KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM354750Help
Entry
Phum_PHUM354750   CDS       T01223                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor, putative
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00562  Inositol phosphate metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM354750
   00562 Inositol phosphate metabolism
    Phum_PHUM354750
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Phum_PHUM354750
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Phum_PHUM354750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8232032
NCBI-ProteinID: XP_002427936
VectorBase: PHUM354750
UniProt: E0VP92
AA seq 441 aa AA seqDB search
MYLSILRCYFIIFIVLSLDKTVNSDCFNSHDYFWKHLATKTPYRYVANNNNSQIVFDGCN
PHKIWAVLRHGTRYPGEKFINKVNVDLVEIQQLIIKNFDDNNSKLCPDSINKIKEWSPQM
NISNSKKLAHEGEDEMIELAERFQERFPSLLQNEYSNSTFKFRSTATERTEQSKYYFLIG
LFGRKVAHHVWSPQSIYKDPTLRFYKLCHRWLKNIYKNPRAYNEAEIFKTSQIFENILED
IADRLGFKDLTFDVVDMMYTACGFESAMNRETSPWCYVFTEKEMKIMEFSRDLKHYWIDG
YGHNINFQQACPMVKDMLTHIKSEDGPRATFYFTHSGAILKLLAHLGLYYDEKRLTHDRF
DHPRLWKVGYIDSFASNLAIVSYKCDDDKLKILAMHQERPVKLPGCPAEGLCPIEKLMKT
YKKSFYNCDFEETCKISTQNL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatccatattacgttgttactttattatatttattgttttaagtttagataag
acagttaatagtgactgctttaattctcatgattatttttggaaacatcttgcaactaaa
actccttacagatatgtggcaaataataataactctcagatagtatttgatggttgtaac
ccccataaaatatgggcagttttacgtcatggtactcgttaccctggagaaaaatttatc
aataaagttaatgtagaccttgtagaaatacaacagttaatcataaaaaattttgatgac
aataatagtaagttatgtcctgatagtattaataaaataaaggaatggtctccacaaatg
aatatatctaattcaaaaaaacttgcacatgagggagaggatgaaatgattgaattggca
gaaagatttcaagaaagatttccttcacttttacaaaatgaatattctaattcaactttt
aaatttagaagtacggcaactgaaagaaccgaacaaagcaagtactattttttgattgga
ttgtttggtagaaaagtagctcatcatgtatggtcacctcaatcaatatataaagatcca
actttaaggttttataaactctgccacagatggctgaaaaatatttataagaatccaaga
gcttataatgaagctgaaatttttaagacatcacaaatttttgaaaatattctcgaggat
atagctgacaggctcggtttcaaagatcttacatttgatgttgttgacatgatgtacaca
gcctgcggtttcgaaagtgccatgaaccgtgaaacgtcaccttggtgctacgtatttacc
gaaaaagaaatgaaaataatggaattttcaagagatttaaaacattattggatcgacggt
tacggtcacaatattaattttcaacaagcgtgcccaatggtgaaagacatgttgacacac
atcaaatcagaggacggtccaagagcaactttttatttcacacattctggagccattctt
aaacttttagctcatctcggtttgtattacgatgaaaaaaggttaacgcatgatagattc
gatcatcctagattgtggaaagttggttacattgattcgtttgccagtaatttggcaatc
gtatcttacaagtgtgatgatgacaaattaaaaatattagcaatgcatcaagagcgtcca
gtcaaattacctggttgtccagcagaaggtctttgtccgattgaaaaactaatgaaaaca
tataaaaaaagtttttacaattgtgattttgaagaaacttgtaaaatatccacacaaaat
ttataa

DBGET integrated database retrieval system