KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM357760
Entry
Phum_PHUM357760   CDS       T01223                                 

Name
(RefSeq) 40S ribosomal protein S13, putative
  KO
K02953  small subunit ribosomal protein S13e
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Phum_PHUM357760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:phu03011]
    Phum_PHUM357760
Ribosome [BR:phu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    Phum_PHUM357760
SSDB
Motif
Pfam: Ribosomal_S13_N Ribosomal_S15
Other DBs
NCBI-GeneID: 8232092
NCBI-ProteinID: XP_002427992
VectorBase: PHUM357760
UniProt: E0VPE8
AA seq 151 aa
MGRMHSPGKGISQSALPYRRTVPTWLKLTADEVKEQIYKLGKKGLTPSQIGVILRDSHGV
AQVRFVTGNKILRIMKAVGHVPDLPEDLYYLIKKAVAIRRHLERNRKDKDSKFRLILVES
RIHRLARYYKTKRVLPPNWKYESSTASALVA
NT seq 456 nt   +upstreamnt  +downstreamnt
atgggtcgtatgcattcacctggtaagggtatatcccaaagtgcacttccgtaccgtaga
acggttccaacatggttgaaactaacggccgatgaagttaaagagcaaatctacaaattg
ggcaaaaagggtctcactccatctcaaatcggtgtaattttaagggattctcacggagtc
gcccaagtaagatttgtcactggaaacaaaattttaagaataatgaaagctgtgggtcac
gttccagacttgcctgaagatttatattacctaattaaaaaggcagtagctattcgaagg
catttagaaagaaacagaaaagacaaggattcaaaatttagacttattcttgtcgagtct
agaattcacaggcttgcccgttattacaaaacgaaaagagttttaccacctaactggaaa
tatgaatccagtacagcttctgctcttgtagcttaa

DBGET integrated database retrieval system