KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM372740
Entry
Phum_PHUM372740   CDS       T01223                                 
Name
(RefSeq) Diacylglycerol kinase epsilon, putative
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00561  Glycerolipid metabolism
phu00564  Glycerophospholipid metabolism
phu01100  Metabolic pathways
phu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Phum_PHUM372740
   00564 Glycerophospholipid metabolism
    Phum_PHUM372740
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Phum_PHUM372740
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     Phum_PHUM372740
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Other DBs
NCBI-GeneID: 8233648
NCBI-ProteinID: XP_002428269
VectorBase: PHUM372740
UniProt: E0VQ75
AA seq 543 aa
MERNRFINVTSFTFPPSVVYNEFGLSPIVTAVTAVVVFILGVKIVRVVFNDVRGPIKEAT
KTHNWKNTTSFQGANYCNICEKIMMTTQGMYCDCCGLFSDVACTPVANKIEPCKAITYPS
SKLMKHHWVKGNLSASSICDVCDTDCSGWGIENFRCCWCLRTIHTACKPRLSELCDFGPY
KKLIIPPSSVEVVTKRTNIKKYLVLKSVKPTDWPGWSPLIVIANCKSGNNDGEEILSAFR
GMLHPGQVIDLRVKKPEAALEWCFLLNDVPCKILVAGGDGTVGWVLNTIANAKLQVLPAV
GILPLGTGNDLSRVLGWGKGISSHVNPALVLDDTLEAETVFFDRWKVIVKPKRSLRIHSV
NKELFMYNYLSIGVDAQVTLDFHRARESPFYIFSNRMFNKLLYFGYGTQQWFEKKCQGLN
EKIELYLDGQKKNLPAIESIVVLNIDSWGAGVHLWKMSETDESKLSQSYNDKKLEVLALY
SSLHIAQLQVGLGSPYRVGQANEVQIVLKSSIAVQVDGEPWMQQPAVFHIFHYDQALMLK
KKI
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggaacgaaaccggtttattaacgtcacaagctttacctttcctccatcagtggtttat
aatgaatttgggctctctcctattgttacagctgttactgctgtagtcgttttcatttta
ggagtgaaaattgtgagggtcgtttttaatgatgttcgcggtcccattaaagaagccaca
aaaactcataattggaaaaatacaacttcatttcaaggagcgaactactgtaatatttgt
gaaaaaattatgatgacaactcagggaatgtattgtgactgctgtggacttttctctgat
gtagcttgcactcctgttgctaacaagattgagccatgcaaagcaataacttatccttct
tctaaattgatgaagcaccactgggttaaaggaaacctttcagcatcaagcatatgtgat
gtttgtgacactgattgctcagggtggggaattgaaaacttcagatgttgttggtgtcta
agaaccattcacacagcctgcaaacctcgtctttctgaattatgtgattttggaccctac
aaaaaattaattattccaccttcatctgttgaagttgttacaaaaagaacaaacataaaa
aaatatttagttttaaaatctgttaaacctaccgattggcctggttggtctccgttaatt
gttatagctaattgtaaatcgggaaataatgatggagaagaaattttatcagcttttaga
ggaatgttacatccaggtcaagtaattgatttaagagttaaaaaacctgaagctgcttta
gaatggtgttttttgcttaatgatgttccttgcaaaattttggttgctggcggtgatgga
acagttggatgggtgttgaacacaatagcaaatgcaaagcttcaagtcttacctgctgtc
ggtatacttcccttaggaactggaaatgatttatcaagagttttaggttggggtaaaggc
atatcgtctcatgtaaatcccgcattggttttggatgatactctagaagcagaaacagtt
ttttttgataggtggaaagttattgttaaaccgaaaagatctttgagaattcattctgtt
aataaagaattgtttatgtataattatttaagtattggtgtagatgctcaggttaccctt
gatttccacagagcgagagaatcgccattttatatatttagcaacagaatgtttaacaaa
ttattgtattttggttatggaacacagcaatggtttgaaaaaaaatgtcaaggtttgaat
gaaaaaattgaattgtatttagatggacaaaagaaaaatcttccagctattgaatctatt
gttgtattaaatattgactcttggggtgctggtgttcatttgtggaagatgagcgaaaca
gatgaaagtaaattaagccaaagttataatgacaaaaagttggaagttttagctttatat
tcgagtttacatattgcccaacttcaagttggtttgggttctccatacagagttggccaa
gctaatgaagtacaaattgtgttaaaatcatcaatagcagtacaagtcgatggtgaacct
tggatgcaacaacctgcagtttttcatatctttcactacgaccaagctttaatgttaaaa
aaaaaaatttaa

DBGET integrated database retrieval system