KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM378990
Entry
Phum_PHUM378990   CDS       T01223                                 

Name
(RefSeq) Guanine nucleotide-binding protein G(O) subunit alpha, putative
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM378990
   04031 GTP-binding proteins [BR:phu04031]
    Phum_PHUM378990
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM378990
GTP-binding proteins [BR:phu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    Phum_PHUM378990
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB Ras AAA_29 NMT1_3 AAA_16
Other DBs
NCBI-GeneID: 8237193
NCBI-ProteinID: XP_002428403
VectorBase: PHUM378990
UniProt: E0VQK9
AA seq 356 aa
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG
FTSEDFKQYRPVVYSNTIQSLVAILRAMPNLGITFGNNEREVSADAKMVFDVIQRMEDTE
PFSEELLTAMKRLWMDVGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRT
RVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHED
ETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGAQEYG
EAAAYIQAQFEAKNKSTTKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgggatgtgcaatgtctgcagaggagcgggctgcgctggctcggagtaagcaaattgaa
aaaaacctaaaagaagacggtattcaagcagctaaagacattaaactgttactactaggg
gccggagaatctgggaagagcacaatagtgaagcaaatgaaaattattcatgaaagtggt
tttacatctgaagactttaaacaatatagaccagtagtttacagcaatactatacaatct
ttggttgccattcttcgtgccatgccaaatcttggtataacatttgggaacaatgaaagg
gaggtaagtgctgacgccaaaatggtgtttgatgtaattcaaagaatggaagatactgaa
cctttttcggaagaattacttaccgccatgaagagattatggatggatgttggagttcaa
gaatgctttggacgatcgaacgaatatcagttaaacgattcagctaaatattttttagat
gacttagatcgattaggagccaaagattatcagcctacagagcaagatatattgagaact
agagtaaaaaccactggaattgtagaagttcatttttctttcaaaaatttaaattttaaa
ttgtttgatgtaggaggtcaaaggtcagaaagaaagaaatggattcattgtttcgaagat
gtcaccgccattatattttgtgtagccatgtcagaatatgatcaagtactacacgaagat
gaaacaaccaatcggatgcaggaaagcttaaaactttttgattctatttgtaacaacaaa
tggtttaccgacacctcaattattctttttctaaataaaaaagatttattcgaagaaaaa
attaaaaaatcgcctcttacaatatgctttccagaatattcaggtgctcaagaatatggg
gaagcagcagcatatattcaagcgcaatttgaagctaaaaacaaatcgacaacaaaagaa
atttactgccatatgacttgtgcaacagatacaactaatattcagtttgtattcgatgcg
gtcacagacgttatcattgctaacaatcttcgaggttgtggtctttattaa

DBGET integrated database retrieval system