KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM390440
Entry
Phum_PHUM390440   CDS       T01223                                 

Definition
(RefSeq) patched 1, putative
  KO
K06225  patched 1
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Phum_PHUM390440
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 8237552
NCBI-ProteinID: XP_002428547
VectorBase: PHUM390440
UniProt: E0VR03
AA seq 1320 aa
MVASTTNNSNIHLEIINDKGKTEAKRFSSCRKDLFIRTSWTDAALALAQIEKGKADGQRT
ALWLRARLQAHLFALGCFLHRHAGKVLFVAVLVLATFCVALKSATIQTKAEDLWVEEGGR
LEKELRYTQKTLGEASGSTHELLIQTSKDSEASLLHSGALLAHLEIVKVATSVSVHLFDI
TWRLKDMCYSPNIPNFDVHYIDQIFENIIPCAIITPLDCFWEGSKLLGPDYPVSIPGIRS
KVKWTNLNPITLVEKMKTFDFTFPFKTLEDYLKRAGISTGYQKKPCLNPKDPECPTTAPN
KNGQVPDIGAELTGGCYGFAAKYMHWPEDLVVGGTKKNKTGHITRAKALQTVVQLMGERE
LFEYWSDTYKVHHVDWTQEKAALVLETWQNRFAEEVRNQIQSDSNTSLYNVYAFSTATLN
NILKQFSEINVFKIGIGYSIMLLYVGLTLLRREDPVRSQTAIGVAGVLLVSVTVAAGLGF
CSLLGIAFNAATTQIIPFLALGLGVDNMFHLTHTYAESDNEGNIDEQTGLVLKKTGLSVL
MTSLCIMCTFFAAALIPIPALRVFSLQAAVLVLFNIGAMLLVFPAIVSLDLRRRKSERVD
LFCCCMPSPEKEPSWPCFLFPLNSRRYENSRKFQTVTRALPPDRKHTVTVIAPTAGSEEK
WIGMADTPFGSKPYNIATKKNVQVSNHYVKWSLTKLVADYYAPFLMKSSVKVISIILLII
VLIGSVWGMMKVTDGLDLTDIVPQNTNEYAFLSAQGNYFGFYNMYAVTRGEFEYPNNQEL
LHEYHQAFIKVSNIMKNDNGGLPEFWLEMFRDWLIGLQKAFDRDWANGCITQERWCANAS
DEGILAYKLLVQTGHVDNPIDKSLVHQVRLVDSKGIINPKAFYNYLSAWSWNDALAYGAS
QANLRPEPRQWYHTASDYELKIPKSAPLVYTQLPFYLSGLGDTQKITNLISEVRAICQKF
EDRGLPNFPSGIPFLFWEQYLALRQNFGLALISALSVVFVIVTVLLLNFWAALLVTFSLA
SMILQLLGLMGIFGIKLSAIPAVLLIVAVGIKVHFTVHICLGFITSVGGKNRRTELALEH
MTAPVIHSAVTTLLGIAMLSFSEFGFIVRYFFYVLLALIAVGLLNGLVFFPVLLSLIGPA
AEVVGIEHLDRISTPSPEPQNIKPRPSSCRVSKVVLPRRHHCNRLHSEPSLTTITEETGS
WHSTHSIQSIIVQPELVVHTTTYNEPNSSNEENIQNNSNSDGSTSSLSSIPTSSCNQNRV
TTKVTATAKVKVELHAPHSKSFQKTSSSSSSSSSSSKKNYGRKKESKVSESSNFIHKYTT
NT seq 3963 nt   +upstreamnt  +downstreamnt
atggtggcctccaccacgaacaatagtaacattcatttggaaataattaacgacaaagga
aaaacagaagcaaaacgcttttcttcttgccgcaaggatttatttatacgtacaagctgg
acagacgcggctttggctctagcccaaatagaaaagggcaaagcagacgggcaacgaact
gctttgtggttgcgagcacgtttgcaagcccaccttttcgcgttgggctgttttctgcat
cgtcacgctgggaaagtcctattcgtggctgttttagtattggctacgttttgcgtcgct
ctcaaatcagccaccattcaaacaaaagccgaggacctttgggtagaagaaggagggcgt
ttagaaaaagaactgagatatactcagaaaacgttaggagaagcttcaggtagcactcac
gaattattaatacaaacatctaaagattctgaggcatcgcttttacattctggagcactt
cttgctcatttagaaattgtcaaagtggcaacaagtgttagtgtgcatctttttgatata
acctggagactgaaagatatgtgttactcaccgaatattcctaatttcgatgttcattat
attgaccaaatatttgaaaacattattccttgtgccataataactcctctggattgtttt
tgggaaggctcaaaattattaggacctgactatccagtgagcatacctggtataaggtca
aaggttaaatggacaaatttaaatcctattacattagttgaaaaaatgaagacgtttgat
tttacatttccgtttaaaacgttggaagattatttaaaaagggctggaataagcactggt
taccaaaaaaaaccttgtttaaatccaaaagatccagaatgtccgacaacggcgccaaat
aaaaatggacaggtacctgatattggtgctgaattaacagggggatgctacggttttgct
gcaaaatatatgcattggccggaagatttggttgttgggggaaccaaaaaaaataaaact
ggtcacattacaagagccaaagctttgcaaacggttgttcagcttatgggagaaagagaa
ctttttgaatattggtctgatacgtacaaggttcaccacgtcgattggactcaagaaaaa
gcggcattagttttggaaacgtggcaaaataggtttgccgaagaagtacggaatcaaata
caaagtgattccaacactagtttatataatgtttacgcattttccacggccacactcaac
aatatattaaaacaattctcagaaataaacgtatttaaaataggaatcggatattcaata
atgttattgtatgtaggattaactcttttaaggcgtgaagatcctgtacggtctcaaact
gcaatcggagtggctggggtattattagtatctgtcactgtagcagctggtttaggtttt
tgttcgcttttagggattgcatttaatgctgcgacaacacaaattataccatttttggct
ttaggccttggtgtagacaatatgtttcatttaactcacacttatgcagaatcagataat
gaaggaaatatcgacgagcaaactgggctcgttttgaaaaaaactggtttgagcgttctt
atgacttcactttgtataatgtgtacatttttcgctgctgctcttatacctattcccgct
cttcgtgtcttctctcttcaagccgccgttttagttttatttaacatcggagcaatgcta
ttggtttttcctgctatagttagtctcgatcttcgacgacgtaaatctgaaagagtcgac
cttttctgttgttgcatgcctagtccagaaaaagagccgtcttggccttgttttttgttt
ccattgaattctcgacgatacgaaaattctagaaagtttcaaactgtaacaagagcatta
ccacctgatcgtaaacacaccgtcaccgtcatagctcctacggcaggttccgaagagaag
tggattggtatggcggatacaccgttcggatctaagccttataatattgctacaaagaaa
aatgttcaagtttcaaatcattatgtaaaatggagtttaaccaaattagttgcagactac
tatgctccttttctaatgaaatcttctgtaaaggttatatctataatactcttaataata
gtattaattggtagtgtatggggtatgatgaaagtcacggatggattggacttgactgat
attgttcctcaaaatacaaatgaatacgcttttctcagtgctcagggcaattattttgga
ttttataatatgtacgccgtaactcgaggagaattcgaatatccgaataatcaggaactc
cttcacgagtatcatcaggcttttataaaagtttctaatataatgaaaaatgacaacggc
ggtcttccagaattttggctggaaatgtttagagactggcttataggtctccaaaaggca
ttcgatagagactgggctaacggttgcattacccaagaaaggtggtgcgcaaacgcttcc
gacgaaggaatattagcgtataaacttttagttcaaacaggtcatgtggataatcctatt
gacaaatcattagttcatcaagttcggctagttgattcaaagggtattattaatccaaaa
gcattttataattatttaagtgcttggtcttggaatgatgctttagcttatggagcatct
caagcgaatttgaggccggagcctcgtcaatggtatcacaccgcgagtgattacgaactg
aaaattccaaaatcggctcccctagtgtacactcaacttccattttatttatctggactt
ggtgacacgcaaaaaataacaaacttgattagtgaagttcgtgcgatttgtcagaaattc
gaagaccgcggactcccgaattttccgtccggtataccctttttattttgggaacaatac
cttgcattaaggcaaaactttggacttgccctcataagtgcgctttctgtagtgttcgtt
attgttacggttctacttttaaatttttgggcagcacttttagttacattttcattagct
tcgatgattcttcaacttttgggattgatgggaatattcggaattaaattgagtgcaata
ccggcagttcttcttattgttgcagtaggaataaaagtacattttaccgtacatatatgt
ttgggatttataacttctgtcggtggtaaaaatcgaagaacggaattggctttggagcat
atgacagcaccagtaattcatagcgctgttacaacattgttgggcatagccatgctttcc
ttttctgaatttgggtttattgttaggtattttttctacgttttattggcgttgatagct
gttggcctcttgaatggtctagtcttttttccggtgcttctctctctgattggccctgct
gccgaggtcgtgggaatagagcatctcgatcgcatttccactccttcaccagaacctcaa
aatattaaacctcgaccatcatcttgccgcgtgagcaaagttgtccttcctcggcgacat
cattgcaatcgtcttcattcggaaccttcgttgaccacaataactgaagaaactggatcg
tggcattcgactcattcgatacaatccataattgtacaaccggaattagtcgtacataca
acgacttacaatgagccgaattcatcaaacgaagaaaacatacaaaataattcaaattca
gatggttctacatcttcactctcatcaattccaacgtctagttgtaatcaaaatcgtgta
actaccaaagtaacggccacagccaaagttaaagtagaattacatgctcctcattctaag
tcatttcaaaaaacttcatcatcatcatcatcatcatcatcatcatcgaagaaaaattat
ggaaggaagaaggaatcaaaagtatcagaatcatctaatttcattcataaatatacaacg
taa

DBGET integrated database retrieval system