KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM390460Help
Entry
Phum_PHUM390460   CDS       T01223                                 

Definition
(RefSeq) mitogen-activated protein kinase ERK-A, putative
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
phu04068  FoxO signaling pathway
phu04624  Toll and Imd signaling pathway
phu04933  AGE-RAGE signaling pathway in diabetic complications
Module
phu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM390460
   04068 FoxO signaling pathway
    Phum_PHUM390460
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Phum_PHUM390460
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Phum_PHUM390460
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Phum_PHUM390460
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Phum_PHUM390460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 8237554
NCBI-ProteinID: XP_002428549
VectorBase: PHUM390460
UniProt: E0VR05
AA seq 357 aa AA seqDB search
MPDFYKIEINRTEWEVPERYQMLTPVGSGAYGQVCSALDKKTKMKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENVIGLLDVFHPSTCLDNFQQVYLVTHLMGADLNNIIRTQRLSD
DHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELITGRTLFPGTDHIHQLSLIMEILGTPNA
EFMKKISSESARNYILSLPTLKKRDFKEVFQGANILAIDLLEQMLELDADKRITAEQALA
HRYLSQYADPSDEPVSAPYDQSFEDMELPVEKWKELVYKEVCTFQPQLLVSNLQQES
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatttttataagattgaaataaatagaacagaatgggaagttccagaaagatat
caaatgttaacacccgttggatctggcgcatacggacaagtttgctcagcattggataaa
aaaacaaaaatgaaagttgccattaaaaaattggctcgtccttttcaatctgcagttcac
gccaaaagaacttatcgagaattaagaatgttgaagcacatgaatcatgaaaatgtgata
ggattactagatgtatttcatccttcaacatgtttagataattttcagcaagtatatctg
gttactcatttaatgggtgctgatttaaataatataattagaactcaaagattatctgat
gatcatgttcaatttttagtttatcaaattctaaggggattaaaatatattcattctgca
ggaatcatacacagggacttaaagccttctaatattgctgttaatgaagattgtgagtta
aaaattttggattttggtttagcacgtccaacagagaatgaaatgacaggttatgttgcc
actagatggtacagagcacctgaaataatgttaaattggatgcactataaccaaacagtc
gatatttggtccgttggatgcattatggcagaattaataactggaagaactttattccca
ggaacagaccatattcatcaattgagtttaattatggaaatactcggaactcctaatgca
gaatttatgaaaaaaatatcaagtgaatccgctagaaattatattttgtcattaccaaca
ttaaaaaaaagagattttaaagaagtttttcaaggagctaacatattggccattgattta
ttagaacagatgttagaattggatgctgacaagaggataacagctgaacaagctttagct
cacaggtatttatctcaatatgctgatccatcagatgaacctgtttcagcaccttacgat
caaagttttgaagacatggaacttccggttgaaaaatggaaagaattagtttacaaagaa
gtttgcacatttcaaccacagttattagtttcaaatttgcaacaagaatcctag

DBGET integrated database retrieval system