KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM399940
Entry
Phum_PHUM399940   CDS       T01223                                 
Name
(RefSeq) phenylalanyl-tRNA synthetase alpha chain, putative
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Phum_PHUM399940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phu01007]
    Phum_PHUM399940
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phu03016]
    Phum_PHUM399940
Enzymes [BR:phu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Phum_PHUM399940
Amino acid related enzymes [BR:phu01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Phum_PHUM399940
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Phum_PHUM399940
 Prokaryotic type
    Phum_PHUM399940
SSDB
Motif
Pfam: tRNA-synt_2d PheRS_DBD1 PheRS_DBD3 PheRS_DBD2 tRNA_synthFbeta tRNA-synt_2b tRNA-synt_2 HTH_11 KIP1
Other DBs
NCBI-GeneID: 8237943
NCBI-ProteinID: XP_002428766
VectorBase: PHUM399940
UniProt: E0VRM2
AA seq 496 aa
MATDLTEKILKIIDSKNEIDTYDLAGELNEDHQKIIGTVKSLQALGNLVKGEPKVHSYWE
LTKEGQSVVENGSHEALIFNAVPPDTGIEQSKIMATVPNAKVGFSKAMSQGWVFIDKSSG
VPVVKRKVDDISDVVRQHLKLILNKDGNSVPDNVKQDYKKRKLIQEVVIKSILLSKGSEF
QLSVEKQETDLTAELLLNDAWKNKTFKDYNFNSLGVLPNSGHLHPLMKVRAEFRKIFIEM
GFQEMPTNNFVESSFWNFDALFQPQQHPARDAHDTFFLSFPATSSNFPTDYLERVKKVHS
SGGYGSQGYQYDWKIEEAQKNLLRTHTTAVSARMLYKLAREKEFKPVKYFSIDRVFRNET
LDSTHLAEFHQVEGLIADYNLSLGDLIGVLYAFFQKLGIEKLKFKPAYNPYTEPSMEIFS
YHPGLKKWIEIGNSGMFRPEMLLPMGLPEDVNVIAWGLSLERPTMIKYGLNNIRDLVGPK
VDICMVQSSPICRLDK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggctaccgacttaactgaaaaaatattaaaaataatcgattccaaaaatgaaattgac
acatatgatcttgctggtgaattaaatgaagatcatcagaaaatcattggtacagttaaa
agtttgcaagctttgggaaatcttgtaaaaggagagccaaaagttcattcttactgggag
ttaactaaagagggacaatcggttgttgaaaatggaagtcatgaagctttgatatttaat
gcagttccccctgatactggtattgaacaaagtaaaataatggcaacagttccgaatgca
aaagttggttttagtaaagccatgtcacaaggttgggtttttatcgataagagtagtggt
gtgccagtagtaaaaagaaaagttgatgatatatctgatgttgttcgacagcatcttaaa
ctaatactaaacaaagatggaaattcagttcctgataatgtaaaacaagattataaaaaa
agaaaattaattcaagaagttgtaataaaaagcatattgttgagtaaaggatctgaattt
caattgtctgtggaaaagcaagaaaccgatttaaccgctgagctattacttaatgacgct
tggaaaaataaaacgtttaaagattataattttaattcgttgggagttttacccaattcc
ggacatttacatccgttgatgaaagttagagctgaattcaggaaaatttttattgaaatg
ggatttcaagagatgcctacaaataattttgtcgaaagttcattttggaatttcgatgcc
cttttccagccacaacaacatccggctcgtgatgctcatgatacattttttttatctttt
cctgccacaagttcaaatttcccaacagactatttggaaagagtgaaaaaagtacacagc
agtggtggatatgggtctcaggggtaccaatacgactggaaaatagaagaagcacagaaa
aatctgcttagaacgcatacaactgcagttagtgcaagaatgctttacaaattggcacga
gaaaaagaatttaaacctgttaaatattttagcatagacagagttttcagaaacgaaaca
ttagacagcactcatttagcagaatttcatcaagttgaaggattaatagctgattacaat
ttaagtttaggtgacttaatcggagtgctttatgcttttttccaaaagttaggaattgaa
aaacttaaatttaaacccgcgtataatccatacacggagcccagcatggaaatatttagc
tatcatccaggactcaaaaaatggatagaaataggaaattccggcatgtttagaccagaa
atgttattgcccatgggtttaccagaagacgttaacgtaattgcttggggcctgagttta
gaaaggcctacaatgataaaatatggtttgaataacataagagatcttgtaggtccaaaa
gttgatatatgcatggttcaatcaagtccgatttgtagattagataaataa

DBGET integrated database retrieval system