KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM411770
Entry
Phum_PHUM411770   CDS       T01223                                 
Name
(RefSeq) collagen alpha-2 precursor, putative
  KO
K19719  collagen type II alpha
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Phum_PHUM411770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:phu00536]
    Phum_PHUM411770
Glycosaminoglycan binding proteins [BR:phu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   Phum_PHUM411770
SSDB
Motif
Pfam: Collagen COLFI VWC PSP94
Other DBs
NCBI-GeneID: 8234150
NCBI-ProteinID: XP_002428942
VectorBase: PHUM411770
UniProt: E0VS48
AA seq 1569 aa
MGSGKKYNFTFFILILFAIILLVNNVEAKEKRKKKIHPSRIHLVKPQAQQPPIGNEPPPP
PQPPRGNEAPNPNYEEYDYGVDYDYDYDENKTGPQPGAPNGKNLRINLLNATTPPPVTTP
PLPTEAPDKECIVDGQVRFHNEVWKSDECTTCRCDNGLVNIPCSGTKYTPYGECCPVCIP
SEPVTPTPEVNRPTYPYEGDAGAFAGPRGETGPPGERGRPGAIGMPGAPGTPGVPGIPGP
PGPSPDLSNFYAQLAMSQSGGDKGPNDVLGRLPFPQEPFSYLQSQVGPPGPRGPPGPPGP
PGPQGFQGVRGEPSESGPPGPPGPPGPRGLPGLPGKDGSPGEDGEPGMAGAAGPPGSRGL
PGMPGLPGIKGHRGFPGLDGAKGEQGPGGEKGSQGSAGPVGPVGPMGPTGPRGERGREGP
PGPPGLRGIDGIAGPPGQPGAIGKPGAPGFPGNPGNKGDQGATGPKGSQGLQGPRGESGR
PGQPGENGQPGPSGKDGSQGEKGSPGAAGLPGPPGFPGARGAPGLSGSPGQPGVKGAPGM
PGERGLKGEQGMKGEAGSPGPRGIPGTSGSEGKRGKRGLRGPTGLAGTQGERGTPGPRGL
PGPDGAIGPKGQSGDRGPPGPQGPKGNTGEPGRPGPPGLQGLRGLVGRPGPAGKTGPPGD
RGIEGADGKPGEQGPQGIQGLPGPIGLPGEKGLTGEPGKDGEPGPQGPVGPRGDAGKDGS
PGAQGPQGPPGAPGERGASGPPGSTGFQGLPGAPGTPGTPGKDGEMGLQGPPGPIGAPGN
RGERGFPGERGSVGPQGSPGARGETGAQGVDGLPGLPGEKGSKGHVGPPGLVGLPGGRGL
PGQPGEKGERGSSGPIGPEGPSGRQGDRGPQGPLGPPGPPGEPAERGDPGPPGLPGEPGA
AGTPGERGPVGQQGIQGFPGLQGPAGSPGAKGERGSNGAKGEQGSPGLAGKPGDPGVAGL
TGLPGPKGIRGEPGPRGEVGLMGPMGRPGEPGTAGHTGPPGPAGAPGIPGSKGSSGDTGR
PGAPGPIGHPGAPGPEGSKGEQGQQGSPGLIGQPGPQGPPGDRGLPGLPGAAGAPGSRGV
RGAPGESGLPGKPGNEGQQGPQGIAGPPGPPGAPGEQGVEGHAGKPGPPGIAGRTGDKGP
VGPAGPMGPPGAPGQQGSPGLVGAPGPAGERGPRGEVGPQGADGPVGPRGSPGVPGEQGV
KGDQGSEGPKGSKGHRGLIGLQGLPGPQGPPGEKGLTGSPGFPGKDGEVGPKGPPGRDGN
PGIAGLQGPPGVRGAPGDEGKSGPPGPPGPPGPPGPPGDSLAYDAATLAALMGQQGSQVK
GPDPLSGDEPPRMFGDISDEERRNLVLKAYEHLKTTFERFKKPDGKKNYPGKTCRDILAA
YPDSPSGEYWVDPNEGDIKDAVLVHCDMEKKATCILPSPSKSDEIKSYGEKPENWLGDME
GGIKMNYKADSNQMGFLQLLSTGAVQNITYHCKNSVASFDAQGKTFRKGIKLLGWNDAEI
LPKSGNHRLQYETIEDTCRFKKPDWAKTVISYKTDKAIRLPIVDIAIRDIGGPDKSFWVE
IGPVCFQHN
NT seq 4710 nt   +upstreamnt  +downstreamnt
atggggagcgggaaaaagtataattttacttttttcattttaattttatttgctattata
ttgctggtcaacaatgttgaagccaaagaaaagagaaagaaaaaaattcatccctctaga
atccatcttgtaaaacctcaagctcaacaaccgccaatagggaatgaaccgccaccacca
ccacaacctccgagaggtaacgaagctccaaatccaaattacgaagaatatgattatgga
gttgattatgattatgattacgatgaaaataaaacaggacctcaacctggagctccaaat
gggaaaaatttaagaattaatttgcttaatgcaacaacacctcctccagtaactactcct
ccattaccaactgaggctcctgataaagaatgtattgttgatggacaagtgagatttcac
aacgaagtatggaaatctgacgaatgtactacttgtcgttgtgataatggtttggtaaac
attccttgctctggaactaaatacacaccctacggagaatgttgtcctgtttgtattcca
tcagaaccggtaactccaactccggaagttaatagaccgacttatccgtatgaaggagat
gctggagcttttgctggaccaagaggagaaactggaccacccggagaaagaggtcgaccg
ggagcaattggaatgccgggtgcacccggtactcccggagttcctggaataccaggaccc
ccaggaccttcaccagatctctcgaatttttacgcacaattggctatgtctcaatcagga
ggtgataaaggacccaatgacgtattaggtagacttccgtttcctcaagaaccattttca
tatcttcaatctcaagttggcccaccgggaccaagaggacctccaggacctcccggtcca
cccggacctcaaggttttcaaggtgtaagaggtgaacccagtgaatctggaccaccagga
ccaccaggaccccctggaccaagaggtttacccggtcttcccggaaaagatggttcacct
ggagaagatggagagcctggtatggcaggagcagcaggtcctccaggttctagaggtctt
cccggaatgccaggattgcccggtataaaaggacacagaggtttcccaggtttagacggt
gccaaaggagaacaaggacccggtggagaaaaaggaagtcaaggatcggctggtccagta
ggacccgtcggaccaatgggaccaactggacccagaggtgaacgtggccgagaaggtcca
ccaggaccaccaggtttaagaggaattgacggtattgctgggcctccaggacaaccaggt
gcaattggtaaaccaggagctccaggttttccaggaaatccaggaaataaaggagatcaa
ggagcaacaggacccaaaggttctcaaggattacaaggaccacgaggagaatcaggaaga
ccaggacaacctggagaaaacggtcaaccaggtccaagtggaaaagacggaagccaagga
gaaaaaggaagccccggtgctgctggtcttcctggaccaccaggatttccaggtgcaaga
ggagctccaggattatctggtagccctggacaacctggagtaaaaggcgctcccggaatg
cctggtgaaagaggacttaaaggagaacaaggaatgaaaggtgaagctggatcaccaggg
cctagaggtattcctggtacttccggttctgaaggaaaacgtggtaaaagaggtttaaga
ggacctacaggtttagctggaactcaaggagaaagaggaacacctggaccacgaggattg
cctggacctgatggagctattggaccaaaaggacaaagtggtgaccgtggacctcccggt
ccgcagggacccaaaggtaacactggtgaaccaggaagacctggaccacccggacttcaa
ggtttaagaggattagttggacgtcctgggcctgccggtaaaactggtccaccaggagat
agaggtatcgaaggagctgatggaaaacccggtgaacaaggaccccaaggtattcaaggt
ttaccaggacctattggtttgcccggagaaaaaggattaactggtgaacccggtaaagat
ggagaacctggaccacaagggccagttggaccaagaggagatgctggtaaagacggttcc
cctggagctcaaggaccacaaggaccgccgggagctcctggagagagaggagctagtgga
ccaccaggatcaactggattccaaggtttaccaggagccccaggtactcctggaacacca
ggaaaagatggagaaatgggtttacaaggacctcctggacccataggtgcacccggtaac
agaggagaaagaggatttcccggagaacgaggatcggtaggtccacaaggtagtcctggt
gccagaggtgaaaccggagcacaaggagtagacggacttccaggattacccggagaaaaa
ggatctaaaggacacgtgggaccacccggacttgtgggtttgccaggaggcagaggtctt
ccaggacaaccaggagaaaaaggagaacgtggatcatctggaccaataggacctgaagga
ccatctggaagacaaggagatcgaggacctcaaggaccacttggacctccgggaccacct
ggagaacccgctgaaagaggagatcctggtccaccaggacttcccggagaacctggagcc
gctggaactccaggagaaagaggacctgttggtcaacagggtattcaaggattccccgga
ttacaaggaccagctggaagtccaggagccaagggagaaagaggatcaaacggagctaaa
ggagaacaaggaagtcccggtcttgcaggtaagcctggagatcccggtgtagcaggatta
acaggattaccaggaccaaaaggaattagaggagaacccggaccaagaggagaagttggt
ttgatgggaccaatgggaagacccggagaacctggaactgctggtcatacaggaccacca
ggtccagctggtgcccctggtattcctggaagtaaaggttcatctggtgacaccggaaga
ccgggagctccaggacccattggacaccctggtgctccaggacctgaaggctctaaagga
gaacaaggacaacaaggaagccctggattaataggacagccaggaccccaaggacctccg
ggagatagaggattgccaggattgccgggagcagcaggtgccccaggtagcagaggagtt
agaggagcgccgggtgaatcaggattgccaggaaaaccaggtaatgaaggacaacaagga
ccacaaggtatagcagggccacctggtcctcctggagctccaggagaacaaggtgttgaa
ggacatgctggaaaaccaggacctccaggtatagcaggtcgtacaggagacaaaggaccg
gttgggccagcagggcctatgggtccaccaggtgcacctggtcaacaaggatcccctggt
ttagttggagccccaggaccagcaggtgaaagaggacctagaggagaagttggacctcaa
ggagcagatgggcccgtgggtccacgtggtagcccaggagttcctggagaacaaggagtt
aaaggagatcaaggatcagaaggtcctaaaggttccaagggtcatcgaggtttgattggt
ttgcaaggtcttccaggtccgcaaggtccaccaggagaaaaaggtttgacaggaagtccc
ggattcccaggaaaagatggagaagtaggtcccaaaggacctcctggaagagatggaaac
ccaggaattgccggattgcaaggacctcctggagtaagaggtgctcctggagatgaaggt
aaatctggacctcctggcccacctggacctccaggaccgccaggaccacccggagactca
ttagcatacgacgcagccactttggcagcattaatgggacaacaaggctctcaagttaag
ggacctgatcctttgagcggagacgaaccaccaagaatgttcggtgacatttccgatgaa
gagagaagaaacttggttttgaaagcttatgaacacttaaaaacaacatttgaaaggttt
aaaaaaccagacggcaaaaagaattatccaggtaaaacgtgtcgagacattttggctgct
tatcctgattcaccatctggcgaatactgggtagatcctaatgaaggagacataaaagat
gctgttttggtccattgtgatatggaaaagaaagccacttgcattcttccgagtccatct
aaatcagacgaaatcaaatcttatggtgaaaaaccagaaaactggttgggagacatggaa
ggcggtattaaaatgaattacaaagcggacagtaatcaaatgggattccttcaattactt
tccaccggtgccgttcaaaatataacataccattgtaaaaattcagtggcttcattcgat
gcacagggtaaaacatttagaaaaggaataaaacttttaggatggaacgatgccgaaata
ttacccaaatccggtaaccacagattacaatacgaaactattgaagacacgtgcaggttt
aagaaaccggattgggccaaaaccgtcatttcgtataaaacggataaagctattcgactt
cccatcgtcgatatcgccattcgagatatcggaggtccggataaatcattttgggtggaa
atcggtccagtttgttttcaacacaattaa

DBGET integrated database retrieval system