KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM420260Help
Entry
Phum_PHUM420260   CDS       T01223                                 

Definition
(RefSeq) Dipeptidyl-peptidase, putative
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phu01002]
    Phum_PHUM420260
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     Phum_PHUM420260
Peptidases [BR:phu01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   Phum_PHUM420260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 8234485
NCBI-ProteinID: XP_002429106
VectorBase: PHUM420260
UniProt: E0VSL2
AA seq 738 aa AA seqDB search
MDSSLHSIHTAISKFLRSDEDDPYSQFILHSKTPVFELNAIAAFENLTHREKLYAHYLSH
ASWYGSLICLFQSSPESPIIFSLVLKVFGEQPIEELKKTSLSNGITHEEFQSILVYSCGV
LTNLANYRSLGNFKYIPGAPVGVFEGIIKSSSAYKKDPQKIMSLWNSVKVAVYSLTDREK
TLGFPDNAVSTFFSANCNKSDADVISKFLNHIGMEAFNTRAFKTLLPDGSPHYEICLASA
EEGNYPSLTKENILFARSHFSVTRGDYSPLMKLVVENLEEAKQYVANEIQEAMLNKYIES
FKTGSLDAHKDGSRYWVKDKGPMVETYIGFIETYRDPAGERADFSGWVAMVNKERSTTYH
KLVESSNSILPTLPWPKEFEKDKFLHPDFTSLDVLTFANSLVPAGINIPNYDSIRQNEGY
KNVTLGNVISSSFKDNSLQFLSSRDQLLLEKYRSKSFDIHVGLHELFGHGSGKLFKKDAH
GKLNFNLSAVVNPLTGHKIDKWYEATENYDSKFNVIASSYEECRAEAVGLYLCSNPQILK
IFGYEGEDADNIIYVNWLSMMWNVIANGPESYSFEKQTWLQAHARARFVILRVLMEAGND
FLTIVETEPGRDLRVKLDRSKIASVGMKTIENFLLKLQVFKSMGDFASASEMYNHYSEVP
THESPWANWKKIAFLHMKPRKLFVQANTEVIDNQVVLKRYEPSFKGIISSWAERFSTKVN
IHQILEDLWLKDQQYFIV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcattgcattctattcatactgcaatttctaaatttctgcggtcagatgaa
gacgatccttattctcaatttattcttcattcaaaaacacctgtttttgagttgaatgct
atcgcagcttttgaaaatttaacacatagagaaaaattatatgctcattacttaagtcat
gcttcttggtatgggagtttaatatgtctctttcagagttcacctgaatctccaattata
ttttcattagttttaaaagtgttcggagagcagccaattgaagaattgaaaaaaacttca
ttgagcaatggtataactcatgaagaatttcagtccattttggtttattcttgtggagtt
ctcactaatttggcaaattatagaagccttggaaattttaaatatattcctggcgcacca
gtaggagtttttgaaggtataattaagtctagcagtgcatataaaaaggatcctcaaaaa
ataatgtcattatggaatagtgtaaaagtagctgtttattctttaactgatagagaaaag
actttaggttttccggataatgctgtgtctacatttttctcagcaaattgtaataaatct
gatgctgatgttatcagtaagtttttaaaccatatcggtatggaggcattcaatacgaga
gcttttaaaactttgttacctgatggaagtcctcattatgaaatttgcttggcatctgct
gaagaaggaaattacccgagtctcactaaagaaaatatattgtttgcacgttcacatttc
agtgttacaagaggtgattactcgcctttaatgaagcttgttgtagaaaatttggaagaa
gcaaaacaatatgttgccaacgaaattcaagaagcaatgcttaataaatatatagaaagc
tttaaaacaggttcattggatgctcataaagatggatctcggtattgggtcaaagacaaa
ggacctatggtggaaacatatataggttttattgaaacatatcgagatccggctggcgaa
cgagcagactttagcggttgggttgcaatggtaaacaaagagagatcaacaacataccat
aaattggtagaatcatcaaattcgattcttcctactctgccttggccgaaagaatttgaa
aaggataaatttctacatccggattttacatctttagacgtgttaacatttgccaattcc
ttagttccagctggaattaacattccgaattatgattcaattaggcaaaacgaagggtac
aaaaacgttactttgggaaacgttatttcatcgtcgtttaaagacaactctcttcaattt
ctttcatcgagagatcaattattacttgaaaaatatcggagtaaatcatttgatattcac
gtgggtcttcacgaattgttcggtcacggtagtggaaagctatttaaaaaagatgcacac
ggaaaattaaattttaatttgtcagctgtggttaatcctcttaccggacataaaatcgat
aaatggtacgaagcgacggaaaattacgattcgaaatttaacgttatcgcatcatcttac
gaagaatgtagagccgaagccgtgggcttatacctgtgttcgaatcctcaaatattgaaa
atattcggttacgaaggtgaagacgcagacaatataatttacgtaaattggttatccatg
atgtggaatgtaatagcaaacggtcctgaatcgtatagtttcgagaaacaaacctggtta
caggctcatgccagagctagattcgttattctcagagtattgatggaagccggaaatgat
tttctgacgattgtcgaaacggaaccaggaagagatcttcgtgtaaaattagatcgtagt
aaaatagcatcggtcggaatgaaaacgattgaaaattttttattaaaattacaggttttc
aaatctatgggtgattttgcatcagcatctgaaatgtacaatcattattcggaagtgcca
acacacgaaagtccttgggcaaattggaaaaaaattgcatttttacacatgaaaccgagg
aaattattcgttcaggccaacaccgaagtaatagataaccaagtcgttttaaaacgttac
gaaccttcttttaaaggcataataagttcgtgggccgaaagattttcgacaaaagtaaac
attcatcaaatattagaagatttatggttgaaagatcaacaatatttcattgtttag

DBGET integrated database retrieval system