KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM422010Help
Entry
Phum_PHUM422010   CDS       T01223                                 

Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit A, putative
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00970  Aminoacyl-tRNA biosynthesis
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Phum_PHUM422010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phu03029]
    Phum_PHUM422010
Enzymes [BR:phu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Phum_PHUM422010
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Phum_PHUM422010
Mitochondrial biogenesis [BR:phu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Phum_PHUM422010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8234523
NCBI-ProteinID: XP_002429143
VectorBase: PHUM422010
UniProt: E0VSP9
AA seq 496 aa AA seqDB search
MLQTSIKKIHGKLKGSNLNTAEVIVNSFKRAEQVLELNSFISMNNNAGLQVESSNEYFKN
GKPRSLLEGIPIAVKDNFCVKDTLTTCGSKMLQNFRPKYTATVVQKLLDSGAILVGKTNM
DEFAMGSGTTTSIFGPTKNIWGSRFSNLCIQEKNDWFIPGGSSGGSAVAVASGICLGALG
SDTGGSCRNPASYCGIVGLKPTYGLLSRYGLIPLVNSMDVPAIMALNVEDTACLLGIMMG
RDENDSTTVSKNLNLALNYSSSSVKGLKIGIPAEYNCQGLSDEIRSAWNDIAKVLYQGGA
SIVPVSMPHTKYSIVCYSILNQCEVASNMARYDGIEFGLRSKEKGNRKNSYVTTRYSGFN
EVVRSRIIAGNFFLLSSNSNKYYEKALKVRRLIADDFNNAWRKGINILLTPTTLTDAPKY
SEYIKKDEREQSAIQDYCTQPANMAGCPAISIPIELSKKGFPISLQLMAPKFEEKTLLGC
ALYIENAVNFKNMNEQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaacttcaatcaaaaagatacatgggaaattgaaagggtcaaacttaaatact
gcagaagttattgtaaacagttttaaaagagctgaacaagttttggagctcaattctttt
attagtatgaataataatgccggtttacaagttgaaagttccaatgaatatttcaaaaat
ggaaaaccaagatctttattagaaggtattcctattgcagtgaaagacaatttctgtgta
aaagacacactaactacttgtggttctaaaatgctacaaaattttaggcccaaatatact
gcgactgttgttcaaaaattattagattctggtgctattttggtaggaaaaacaaatatg
gatgaatttgctatgggttctggtacaaccacttcaatttttggcccaactaaaaatatt
tggggttctaggttttcaaatttatgtattcaagaaaaaaatgattggtttattcctgga
ggtagttctggaggaagcgctgttgcagtagccagcggaatatgcttaggtgctttgggt
tcagatacaggaggatcttgtagaaatcctgcttcatattgtggcattgttggattaaaa
cctacttatgggttactttcaaggtatggattgattcctttggttaattcaatggatgtt
cctgcaattatggcacttaatgtcgaagatacagcctgtttattaggtatcatgatgggt
agagatgaaaatgactctactactgtatcgaaaaatttaaatttagccctaaattattca
tcatcatcggtaaaaggtttgaaaattggaattcctgcagaatacaattgtcaaggtcta
agtgatgaaatacgttcagcatggaacgatattgcaaaagttttataccagggtggtgca
tctattgtacctgtatcaatgcctcatacgaaatattcaattgtctgctattcgatactt
aatcagtgtgaggttgctagtaatatggctagatatgatggaatcgaatttggtctcagg
tcaaaagaaaagggtaacagaaaaaattcatatgttaccactagatattctggatttaat
gaagttgttcgtagtagaataatagcaggaaattttttcttattgtctagcaattcgaat
aaatattatgaaaaagctttaaaagttagaagactcattgctgatgattttaataacgct
tggagaaaaggtataaatattttgctaacgcctaccacattaacagatgctcctaaatat
tcggaatatattaaaaaggatgaaagagaacagtcagcaatacaagattattgcactcaa
ccagctaatatggcaggttgtcccgcgatatccatccctattgaattgtcaaaaaaaggt
tttccaataagtttacaattaatggcccccaaatttgaagaaaagactttactaggatgc
gctttatatatagaaaatgctgttaattttaaaaatatgaatgaacaatga

DBGET integrated database retrieval system