KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM423990
Entry
Phum_PHUM423990   CDS       T01223                                 

Name
(RefSeq) male sterility domain-containing protein, putative
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    Phum_PHUM423990
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Phum_PHUM423990
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     Phum_PHUM423990
SSDB
Motif
Pfam: NAD_binding_4 Sterile 3Beta_HSD Epimerase Polysacc_synt_2 RmlD_sub_bind KR GDP_Man_Dehyd Semialdhyde_dh
Other DBs
NCBI-GeneID: 8229934
NCBI-ProteinID: XP_002429200
VectorBase: PHUM423990
UniProt: E0VSV6
AA seq 521 aa
MSDPNNIGSDIISFYRGKSIFVTGGTGLMGKVLVEKLLRTCPGINKIYLLMRPKKGNDVN
TRLSELINTRIFDGIRKTHPETMSKLISVAGDITAPNLGLNSSDVKILTENVSIVFHSAA
TVKFDESLKESVAMNMNGTKSVVQLCQKMKNLEALVHVSTAYCNCDKEDISEVIYPPPDD
PEKIMKCVECMDKELLENITPQIIRSRPNTYTFTKALAEHIVLKEGVGLPVAIVRPSIVT
AAWKEPLPGWIDNLNGPTGLLAGAGKGILRTLLCYRELIADLIPVDIAINLLVTVAWHTA
QTRPDNVPVYNCTSGGLNPIRWMDVETWGHSSLTTLPFNDVIWYPGGSFKSSKIINILCQ
SFFHFIPAYLIDTVSVLIGRKPMMVRVQKKFKKAISVLEFFTTHEWKFHSTNVRNLLLKL
NEHDRKLFNFDVKQVNWKKYIDNYVEGIRLYILKEDPESSHKAKINLRKMYVLHKMTQIL
SLLFLIKILIGSKMEIVRKMWTSLWTISLYLARFISNSIRF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtcagatccgaataatattggtagtgacataataagtttttatcgtgggaaaagtatt
tttgtgacaggaggtacaggtttgatgggtaaggtattggttgaaaaattattaagaaca
tgtcctggaataaataaaatatatttattgatgagaccgaaaaaaggaaacgatgtcaac
acaagactatcagaactcattaacacaagaatttttgatgggatacgaaaaacacatccg
gaaacaatgagtaaattaatatccgttgctggagatataacggctccaaatttaggatta
aattcatccgatgttaaaattctaacggaaaacgtttcgattgtttttcattctgctgcc
acggttaaatttgacgaatcattaaaagaatcagtcgctatgaatatgaatgggacaaaa
agcgtcgtacaactttgtcaaaaaatgaaaaatttagaagctttggttcacgtttcgaca
gcttattgtaattgcgataaagaagatataagtgaagttatttatccacctccagacgat
ccggaaaaaataatgaaatgtgtcgaatgcatggataaagaactattggaaaatataact
ccacaaatcattcgttcgagaccaaacacttatacatttacaaaagcactagcggaacat
atcgttttaaaagagggtgtcggacttccggttgccatcgtcagaccatcaatcgttacg
gctgcatggaaagaaccgcttccaggttggattgataatttaaacggaccaacgggttta
ttagctggagcgggtaaaggaattcttcgtaccttactttgttacagagaattaattgcg
gatttgattccggtcgatatagcaattaatttattagtcaccgttgcatggcacactgct
caaacaagacctgacaatgtacctgtttataattgtacgagcggtggattaaatccgata
cgttggatggacgttgaaacttggggacattcttctctaacgactttaccatttaatgac
gtcatttggtatccgggaggtagttttaaaagttctaaaataataaatatcctttgtcaa
agtttttttcattttatacccgcttacttaatcgatacggtatccgttttaatcggacgt
aaaccaatgatggttcgagttcaaaaaaaatttaaaaaagcaatatccgttcttgaattt
ttcacgacgcacgaatggaaatttcattcgacgaatgtgagaaatttattattgaaatta
aacgaacatgataggaaattgtttaattttgatgttaaacaagttaattggaaaaaatac
attgataattacgtcgaaggaataagactttacatattgaaagaagatccggaaagttca
cataaagctaaaattaatttaagaaaaatgtacgttcttcataaaatgactcaaatttta
tcattgttatttttaattaaaattctcatcggtagtaaaatggaaatcgttagaaaaatg
tggacttcgttatggactattagtttatatctggctcgatttatttcaaattccatccgt
ttttaa

DBGET integrated database retrieval system