KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM424350Help
Entry
Phum_PHUM424350   CDS       T01223                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00061  Fatty acid biosynthesis
phu00620  Pyruvate metabolism
phu00640  Propanoate metabolism
phu01100  Metabolic pathways
phu01212  Fatty acid metabolism
Module
phu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Phum_PHUM424350
   00640 Propanoate metabolism
    Phum_PHUM424350
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Phum_PHUM424350
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Phum_PHUM424350
Enzymes [BR:phu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Phum_PHUM424350
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Phum_PHUM424350
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Phum_PHUM424350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-GeneID: 8234596
NCBI-ProteinID: XP_002429216
VectorBase: PHUM424350
UniProt: E0VSX2
AA seq 2251 aa AA seqDB search
MSQGMINNRSLEKDFTVASPEEFVKRFKGTRVINKVLIANNGIAAVKCMRSIRRWSYEMF
KFERSIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIALRCQVQAV
WAGWGHASENPKLPELLHKNNIVFIGPPEKAMWTLGDKIASSIVAQTAEIPTLPWSGSGL
IATFSERNKRIKISSELYKEGCVQTVEDGLAAAQKIGFPVMIKASEGGGGKGIRKVESGE
EFPNQFRQVQAEVPGSPIFIMKLARCARHLEVQLLADQYGNAISLFGRDCSIQRRHQKII
EEAPAIIAKLEVFEDMERAAVRLAKMVGYVSAGTVEYLYDTNGNYYFLELNPRLQVEHPC
TEMVSDVNLPAAQLQVAMGLPLYKIKDIRLLYGESPWGDNEIDFDQPRHKPQPWGHVIAA
RITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGETRE
QARENLVIALKELSIRGDFRTTVEYLITLLETKSFQENSIDTAWLDILIAERMQAEKPNV
LVGVISGALHVADRAITNNFQSFQQALERGQIQGSNTIDHTVSVELINEGLKYKVQVTKS
GPTSYFLVMNGHFKEIEVHRLSDGGLLLSVDGASCITYMKEEVDRYRIVIGNQTCVFEKE
NDPSLLRSPSAGKLLNFLIDDGGHLEAGQAYAEIEVMKMVMTLSATETGTLVYVKRPGAV
LDAGSLIAHLELDDASLITKALDYKGGFPDADVSAPIVGEKLNQLHNSYRCMLDNILAGY
CLPDPYHEPRVREVIEKFMTSLRDPSLPLMELQEVISSISGRIPISVEKKIRKLMSLYER
NITSVLAQFPSQQIASVIDSYAATLQKRTDRDVFFLTTQGIVQLVQRYRNGIRGRMKSVV
HELLKQYYAVESQFQLGHYDKCVSAIREKHKDDMAAVTSLIFSHGQVSKKNFLVTKLIDH
IWDNEPGLTDELASILNELTSLNRQEHSRVALRARQVLIAAHQPAYELRHNQMESIFLSA
VDMYGHEFHPENIQKLIQSETSIFDILHDFFYHSNKAVCNAALEVYVRRTYISYDLTCLQ
HLELSGEVSLVHFQFLLPSSHPNRIPINKLNHDSNDLECSLSFSPQNWFRTGVMTAFQSF
EQFEMYADEILDLVKDSLRNVNVSNKVLEAVENASESRNSGSNSVSLNLGDAIRIEEQNQ
KSEPIHILSIAVKDHNKSDDSTLSKMFGDFCRTNLEELTDRGIRRITFLVLNKKQFPRFF
TYRQRDGFQEDRIYRHLEPGMAFQLELNRMRTYDLEALATANRKMYLYLGKAKVAKGQEV
TDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHSKRTDCNHIFL
NFVPTVIMDPAKIEESVTNMVMRYGPRLWKLRVLQAELKMTIRTTPNSKTETIRLCLAND
SGYYLDICMYKEITDPKTGTIKFEAYGSKQGPMHGLPITVPYVTKDYLQQKRFQAQSTGT
TYVYDIPDMFRQMTDKLWRDYMDENPQEDISIPSQLMNYVELVLDDDNKLIETKRLPGEN
DVGMVAWKVSLNTPEYPTGREIIVIANDLTYLIGSFGPREDKVFCLASEMARKLKIPRIY
ISVNSGARIGLAEEIKALFKIAWEDPDEPDKGFKYLYLTTEDYAKVSALNSVKTVLIEDE
GERRYKITDIIGKDDGLGVENLRYAGMIAGETSEAYKEIVTISMVTCRAIGIGSYLVRLG
QRVIQIENSHIILTGYQALNKLLGREVYASNNQLGGIQIMYNNGVSHKTEPHDLDGIYTI
LKWLSYIPKDKYSIVPIIKVSDPIDREISYMPTKTPYDPRWMLAGRIINDGTDWESGFFD
RGSWDEIMAPWAQTVVCGRARLGGIPVGVIAVETRTVELNLPADPANLESEAKTVSQAGQ
VWFPDSAYKTAQAIQDFSKEGLPLFIFANWRGFSGGMKDMYEQVIKFGAYIVDGLREYTQ
PIIIYLPPNGELRGGAWAVVDMTINPRYMEMYADPESRGGVLEPQGIVEIKFRMRDLLKT
MHRIDPVILSIKNEMMSKGEMLPEQKAAYEKKIKARETFLAPMYHQVAVQFADLHDTPER
MQEKGCILDIVPWRNSRKFFYWRLKRLVLENEVKNKLLDIQPDLTVGQASSMLRRWFTEQ
EGPAKVYMWDNNEEVIEWLENPETKMKLEENMEAVKRNSIVEQISHKVKECPQAAMDSLI
GIFEILSPSQRVESHAHLESLLQKLESEQHP
NT seq 6756 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagggaatgataaacaatcgatccctggaaaaggatttcaccgttgcgagtccg
gaagaattcgtcaaaaggttcaaaggaacgagagtcataaataaggttctcatcgccaac
aatggtatagctgccgttaaatgcatgagatcgataagaagatggtcgtatgaaatgttt
aaatttgaaaggtcgatcagatttgtcgtaatggttacgcccgaagatttaaaagcgaat
gcggaatatataaaaatggccgatcactacgttcccgtacccggcggtgctaataataat
aattatgccaatgtcgaattaatattggatatcgctctcaggtgccaagttcaggctgtt
tgggcaggatggggtcacgcgtcagagaacccaaaactaccggaattacttcacaaaaac
aatattgtatttataggaccaccggaaaaggccatgtggactttgggtgataaaattgca
tcttcaatcgtggcacaaacggctgaaataccgactctaccttggtcgggaagtggtctc
atcgccacattttccgaacgtaacaaacgaataaaaatctcgtcggaactttacaaagag
ggttgcgtacaaactgttgaagatggtttggcggcggcgcaaaaaataggatttccggtc
atgataaaagcatccgaaggtggagggggaaagggaatacgtaaagttgaaagcggcgaa
gaatttcccaatcaatttagacaggttcaagcggaagtacctggatctcctatatttata
atgaaattagcgagatgcgcaaggcatttagaagttcaacttttagcggatcaatacggt
aatgcgatatcgttgttcggacgagattgttccattcaaagaaggcatcagaaaatcata
gaggaagctccagccataatagcaaaattggaagttttcgaagacatggaaagagcggcg
gtcagattggccaaaatggtcggttacgtgagcgcgggaaccgttgaatatttgtacgat
acaaatggcaattattactttttggaattgaatccgaggttgcaagtggaacatccgtgt
acggaaatggtgtccgacgtgaatctaccggccgctcaacttcaagtagccatgggtttg
cccctgtacaaaatcaaagacataagacttttgtacggtgaaagtccttggggtgacaac
gaaatagatttcgatcaaccccgacataaacctcaaccctggggtcacgtcattgcggcg
agaatcacgagtgaaaatcccgacgaaggtttcaaaccgagttccggaacggttcaagaa
ttaaattttagatctagtaaaaacgtttggggatattttagcgtcgccgcgagcgggggc
cttcacgaatttgccgattctcaattcggtcattgtttttcctggggagaaactcgggag
caggctagggaaaatcttgtgatagcattaaaagaattatcgatccgtggagattttcgt
acgacggtagaatatttgattacattgttagaaacgaaatcgtttcaagagaattcgatc
gacacggcttggttggacatattgattgcggaaagaatgcaagcggaaaagcccaacgtt
ctcgtcggtgtcatttccggtgctttacacgtcgccgacagagcaataacgaataatttt
caaagttttcaacaggcattggaaaggggtcagattcaagggtccaacacgatagatcac
accgtgagtgttgaattgatcaacgaagggttgaagtacaaagttcaagtgacgaaaagt
ggtccgacctcttattttttggtcatgaacggtcattttaaagaaatcgaagttcatcgt
ttatccgatggtggtcttctattgtcggtcgacggagccagttgcataacgtacatgaaa
gaggaagtggacagatataggatcgtcatagggaatcaaacgtgcgttttcgaaaaggaa
aatgatccctcgctccttagatctccctccgctggaaaacttttaaattttttaatagac
gacggtggtcatttggaagctgggcaagcttacgcggaaatcgaagtcatgaaaatggtt
atgacattatcagctaccgaaacgggaactctcgtatacgttaaaagacccggagccgtt
ttagatgccggatctctaattgctcatcttgaactcgacgatgcttccctcattaccaaa
gctttggattataagggaggatttccagatgcggatgtttccgctcccatcgtgggtgaa
aaactgaatcagttgcacaacagctacagatgcatgcttgataatatattggcaggttat
tgtttaccggatccatatcacgaacctcgagtccgagaagttatcgaaaaattcatgacg
tcattgcgtgatccgagtttaccattgatggaattacaagaagtcatttcatccatttcc
ggtcgaataccgatttccgtcgaaaagaaaattagaaagttgatgagtttgtacgaaaga
aatataacatcggtgttggctcagtttcccagtcagcaaatcgcgagcgtcatcgatagt
tatgctgcaacgttacagaagcgtacggacagagatgtatttttcttaaccacgcaagga
atcgtccaattagttcaacgttacagaaacggaatccgtggaagaatgaaatccgtcgtt
cacgaactcttgaaacaatattatgccgtcgagagtcaatttcaattaggtcattacgac
aaatgcgtgtcggccataagggaaaaacacaaagacgacatggcggcggtcacgtccctc
atattttcacacggtcaagtttctaaaaaaaattttctcgtgacgaaactcatcgatcac
atttgggacaacgagccgggtctcacggacgaattggcatccatactcaacgaattgacg
tctctcaatcgtcaggaacattcgagagtcgcactgagagctcgtcaagttctgatagca
gctcatcaacccgcctacgaattacgtcacaatcaaatggaaagcatatttttatccgcc
gtagacatgtacggacacgaatttcatccggaaaacattcaaaagctcatacaatcggaa
acgtccattttcgacatacttcacgacttcttttatcattcgaacaaggccgtttgcaat
gctgccttggaggtttacgttcgtcgaacgtacatttcgtacgatttgacgtgtctccaa
catttagaattgtccggagaagtcagtttggtacattttcaatttttacttccctcgtct
caccccaatagaataccgataaacaaattaaatcacgattctaacgatttggaatgttcg
ctatctttcagtcctcaaaattggtttagaactggcgtcatgacggcttttcaatccttt
gaacaattcgaaatgtacgcggatgaaatattagatttggttaaggatagtttgagaaac
gtgaacgtttcgaacaaggttttggaagccgtcgaaaacgcttcggaatccaggaattcc
ggtagcaacagcgtgagccttaatttaggcgacgccataagaatcgaagaacaaaatcag
aaatccgaacccattcatattttaagcatagccgtcaaggatcataataaatcggatgat
tcgactttgagtaaaatgtttggggatttttgtcgaacgaatttagaagaattaacggat
cgtggaatcaggaggataacatttttagttttaaataaaaagcaatttcccaggtttttc
acgtacaggcagagggacggatttcaagaagacaggatttacaggcatttagaaccgggt
atggcttttcaattggaattgaacagaatgagaacgtacgatttggaagctttggcaacg
gccaacaggaaaatgtacctgtatttgggaaaggcaaaggtcgcgaaaggtcaagaggtc
acggactacagatttttcatacggtcaataattcgacattcggatttaatcacgaaagaa
gcatctttcgaatacctgcaaaacgaaggggaaagagttttgctggaagccatggacgaa
ttggaagttgcgttcagtcatcctcacagcaaacgaacggattgcaatcatatatttttg
aatttcgtacctacggtgataatggatccggcgaagatcgaagaaagcgtgaccaacatg
gtgatgagatacggtccgaggttgtggaaactcagagttttgcaagcggaattgaaaatg
acaatacgaacgactcccaacagcaaaacggaaacgataaggttgtgtttagcaaacgac
agcggttactacttggatatatgcatgtacaaagaaataacggatccgaagactggaacg
ataaaattcgaagcttacggatcgaaacagggacccatgcacggtcttccaatcacggtg
ccttacgtaacaaaagattacctgcagcaaaaaaggtttcaagctcaaagcactggaacg
acatacgtctacgacataccggacatgtttcgtcaaatgacggataaattatggagggat
tacatggatgaaaatccacaagaggacatatccataccatcgcaactgatgaactacgta
gaattggttctggacgacgataataaattaatcgagacaaaaagactgccgggagaaaat
gatgttggaatggtcgcgtggaaagtgtctttaaacactccggaatatcctacgggtaga
gaaatcatagtcatagccaacgatttaacttatttaattgggtcttttggacctcgcgaa
gacaaagttttttgcctcgcgagcgaaatggcgagaaaattaaaaattcctagaatttac
atttccgttaatagcggagcgagaataggtttagcagaagaaattaaagctttgtttaaa
attgcttgggaagatccggatgaacctgataagggatttaaatatttgtacctgacgact
gaagattacgcaaaggtttcggctttgaattcggtaaaaaccgttttgatagaggatgaa
ggagaaagaaggtacaagataacggatattataggaaaagacgacggtttgggtgttgaa
aatctcaggtacgctggaatgattgcgggagaaacatcggaggcttataaggaaatagtt
acgattagtatggttacttgccgagccatcggtatagggtcttatttagttagattaggt
caaagggtcattcaaatagaaaattcacacatcattctcaccggttatcaggctctgaat
aagttgttgggacgagaagtgtacgcgagcaacaatcaattgggtggaattcaaatcatg
tacaacaatggagtctcacataaaacggagcctcacgatcttgatggcatctacacgata
ttaaaatggctctcttacattcccaaagacaaatactctattgttcctataataaaagta
tctgatccgatagacagagagatatcatacatgccaacgaagactccatacgatccaagg
tggatgttagccggaaggataataaacgacgggaccgattgggaaagtggatttttcgac
aggggttcgtgggacgaaataatggctccatgggctcaaaccgttgtttgcggaagagct
agattgggtggtattcccgtgggagtcatcgccgtcgaaacaaggacggtagaattgaat
ttgcctgcagatcctgccaatttggaatcggaggctaagactgtttcccaagccggtcag
gtatggtttcccgattccgcatataaaaccgctcaagcgattcaagatttttccaaagaa
ggccttcccctgtttattttcgccaactggagaggtttctccggcggcatgaaagacatg
tacgaacaagtgatcaaattcggagcttatatcgtcgacggattaagggaatacactcaa
cccataattatttaccttccgccgaacggagagctgcgaggaggagcgtgggcggtcgtg
gacatgacaataaatcccaggtatatggaaatgtatgcggatccggaatcgagaggagga
gttttggaacctcaaggaatcgtagaaattaaatttcggatgagagacctcttgaaaact
atgcacagaatcgatcccgtcattctatcgataaaaaatgaaatgatgagcaagggagaa
atgttacccgagcagaaggcggcctacgagaaaaagataaaagcgcgggaaacgtttttg
gcacccatgtaccaccaagtcgcggtgcaattcgcggatttgcacgacacgccggaaaga
atgcaagaaaaaggttgcatattagacattgtgccgtggagaaattctagaaagttcttt
tactggagactgaaaagattggttttggaaaacgaagtcaaaaacaagctgttggacata
caaccggacttgaccgtaggacaagcgtcgtcgatgcttagaagatggttcaccgaacaa
gagggaccggcgaaagtgtacatgtgggacaataacgaagaagtcatagagtggttggaa
aatccggaaacgaaaatgaaactggaggaaaacatggaagccgtgaagaggaattcgata
gtggaacaaataagtcacaaggtcaaagagtgtccacaagctgccatggacagcttaatt
ggaatatttgaaatattgagtcctagtcaaagagtcgaatctcatgctcatcttgaatct
cttttgcaaaaactcgaatccgaacagcatccttga

DBGET integrated database retrieval system