KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM428030
Entry
Phum_PHUM428030   CDS       T01223                                 

Name
(RefSeq) sumo-1-activating enzyme E1a, putative
  KO
K10684  ubiquitin-like 1-activating enzyme E1 A [EC:6.2.1.45]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Phum_PHUM428030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phu04121]
    Phum_PHUM428030
Enzymes [BR:phu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     Phum_PHUM428030
Ubiquitin system [BR:phu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   Phum_PHUM428030
SSDB
Motif
Pfam: ThiF E1_4HB
Other DBs
NCBI-GeneID: 8230126
NCBI-ProteinID: XP_002429326
VectorBase: PHUM428030
UniProt: E0VT82
AA seq 337 aa
MVAGQANELTEDEAELYDRQIRLWGLESQKRLRNSRILIIGVKGFGAEIAKNIILSGVKS
VVLLDDGVLTEEDTCSQFLAPVELVGSSRAEASLMRAQALNPMVNITADTSRIQEKNENF
FKNFDVVIATECTLSELKRINQICRGNNIKFFCGDVYGMFGYIFADLQVHQYVEEVTKLP
SGKGDGKKKLEPVKITVKDTANFVSLSKALGVDWSKPENAKKLTKMDYSYFLMRVLLEFR
TKYNRKPDPKNRMADIDTLSSLSKTVLTSLQVPQDKIPTTVFSNVFAEISPVCAIVGGVV
SQEIVKAVSQREAPHNNFFFFNPDNFCGFVETHSSSD
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggttgccggtcaagcaaacgaattaactgaagatgaagctgaactttacgatcgtcaa
atacgtttgtggggtctcgaatcacaaaaaaggcttagaaattcacggattcttattatc
ggagtaaaaggtttcggtgcggaaatagcaaaaaatataattttatcaggtgtgaaatcg
gttgttttattagatgatggagtactcactgaagaagatacctgttcacaatttttggcg
ccagttgaacttgttggatcatcgagagctgaagcatcattgatgagagctcaagcactt
aatcctatggtcaacataacagctgacacgagtcgaattcaagaaaaaaatgaaaatttt
tttaaaaattttgatgtcgtcatagcgactgaatgcacattatcagaattgaaaagaatc
aatcaaatatgtagaggaaataatattaaatttttttgcggtgatgtttacggaatgttt
ggctacatatttgcagatcttcaagttcatcaatatgtcgaagaagtgacaaaattacca
agtggaaagggagatgggaaaaaaaaattagaaccagttaagataacagttaaagatact
gcaaattttgtttcattgtcgaaagcattaggggtggattggtcgaaacctgaaaatgct
aaaaaattgacaaaaatggattattcatatttcttaatgagagtgctgttagaatttagg
accaagtataatagaaaaccagatccgaaaaatcgaatggccgatattgatacattgagc
tctcttagtaaaactgttttaacaagtcttcaagttccacaggataaaataccgacaaca
gtattcagtaacgtttttgctgaaatcagtccagtttgtgctatagtcggaggagttgtc
agtcaagaaatagttaaagcagtttcacaaagagaagctccccataataattttttcttt
ttcaatccagataatttttgtggattcgtcgaaactcattcgagcagcgattaa

DBGET integrated database retrieval system