KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM429190Help
Entry
Phum_PHUM429190   CDS       T01223                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor, putative
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00562  Inositol phosphate metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM429190
   00562 Inositol phosphate metabolism
    Phum_PHUM429190
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Phum_PHUM429190
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Phum_PHUM429190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8230132
NCBI-ProteinID: XP_002429332
VectorBase: PHUM429190
UniProt: E0VT88
AA seq 445 aa AA seqDB search
MNPYLKFGTKTAYEFVYERPRLRDQKILDCEPVQIWMLARHGTRYPGRKSIRELSQLQHL
KVEIIRNHEELKNGRLCYADINTLKSWSFNVKMSDANLLTKQGYSDLYFLAKRLKTKYQS
FFQKGYSPNLFRFRHTDSERTRQSAQAFAEGLFEPNQGVWIPPAVVNDTIIKPYENCTHW
IKQVKDNPMNQKETELFKLTEDMQTLVHNVSSRLGFLYDLSVDTIETIYDMCRFDKSWNL
NDRSPWCAAFTRSELRTLEYLEDIQAYYDSGYGDDLNLRLGCTTVKDMLEGFRHFPDQEP
MGKFYFSHASVLLMTLARLGIANHGIPLRHDNFQEQKNRDWKTSELSPFAANLIAVFYKQ
VLELCFDTFMFFVNERRIDYEGCDVGLCSWSYIRDKFDDVFESCNLEWCKSRGGSFIYFQ
NSIFYWILCQIIILVFKSSVKIFNS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatttaaaatttggcactaaaacagcttatgaatttgtttatgaaagaccc
agattaagagatcaaaaaatattagattgtgaaccagttcaaatatggatgcttgcaaga
catggtaccagatatcctgggagaaaaagcattcgggaattatcacaattgcaacattta
aaagttgaaattatacgaaatcatgaagaacttaaaaatggaagattgtgttacgcggat
atcaacacgttaaaaagttggtcgttcaatgttaaaatgtcggatgctaatttattaacc
aaacaaggatattctgatttgtattttctggcaaaaagattaaagactaaatatcaatct
ttttttcaaaaaggatacagtccaaatctttttcggtttaggcacacggattctgaaagg
actaggcaaagcgcacaagcttttgccgaagggttatttgaacctaatcaaggtgtctgg
ataccacctgccgttgtaaacgataccatcataaaaccttatgaaaattgcacgcattgg
attaaacaagttaaagataatccgatgaatcaaaaagaaacggaattgtttaaattaacc
gaagatatgcaaactttggtacataacgttagttcgagattaggatttttatacgattta
tccgttgacacaattgaaacaatctatgatatgtgcaggtttgataaatcatggaattta
aatgatcgttcaccatggtgtgctgcttttacaagaagcgaattgcgtactttggaatat
ttggaagatatacaagcttattacgattcaggatatggagacgatttgaatttacgtttg
ggatgcacaactgtaaaagatatgcttgaaggattcaggcatttcccggatcaagaaccc
atgggtaaattttatttttcccacgcttctgttcttttaatgacattggcaagattgggt
atcgcaaatcacggtatccctctacgacacgataattttcaagagcaaaaaaatcgagat
tggaaaacgtctgaactgagtccatttgctgctaacctgatagcagtcttttacaagcaa
gttttagaattatgcttcgataccttcatgtttttcgttaacgaaagaagaatcgattat
gaaggatgcgacgtaggtttatgttcctggtcgtacataagagacaaattcgatgatgta
ttcgaatcttgcaatttggaatggtgtaaaagtcgaggaggttcttttatttattttcaa
aattccatattttattggattttgtgtcagattattattttggtatttaaatcatctgta
aaaatttttaatagttaa

DBGET integrated database retrieval system