KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM433640Help
Entry
Phum_PHUM433640   CDS       T01223                                 

Definition
(RefSeq) methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00450  Selenocompound metabolism
phu00970  Aminoacyl-tRNA biosynthesis
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Phum_PHUM433640
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Phum_PHUM433640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phu01007]
    Phum_PHUM433640
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phu03016]
    Phum_PHUM433640
Enzymes [BR:phu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Phum_PHUM433640
Amino acid related enzymes [BR:phu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Phum_PHUM433640
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Phum_PHUM433640
 Prokaryotic type
   Other AARSs
    Phum_PHUM433640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 8230449
NCBI-ProteinID: XP_002429460
VectorBase: PHUM433640
UniProt: E0VTJ5
AA seq 551 aa AA seqDB search
MFQKKFIANASKGKIISRFKHIKYLEVRWKSTYFLTTPIFYVNAEPHIGHLYTTTIGDAI
SRYKKLKNCNVKYMVGTDEHGLKVSKAAKALNLNVETFCDNVSEKYKSLFNAFDIRYNDF
IRTTEKRHKKTAIELWDKISSVDLIYKGEYSGWYCEADETFIPENELEPNDDPLVRYTLN
EKKIVNYVTELNYKFKLSKFQNDLLHWLDSGEIIKPNKFQKILRNWIEEGNVLKDLSISR
PTERVSWGIPVPKDPTQTFYVWFDALSSYLSTDGYPYSNFKWPPDLQIIGKDILKFHGVF
WPAFLMAAGLEPPKCILCHSHWMKDNMKISKSTGNVINPFSYAEKYSSDGVRYYLLKEGV
AHSDGNFTDKKLIAMLNADLADKFGNLLLRCTSLTINRNQKYPSFLKGDRKRFHTTDSEN
LINALQDLPDKVDMHFEDFNFYKGIDEIITTLSLTNKFFESEKPWYLANKSDESDHLNYV
IHLTMESLRVCGILLQPIIPKISENLLNKLSIPISKRKIFNIRPFSWECDGSTESYDISQ
DKIMLFTKIKN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaaaaaatttattgcaaatgcatctaagggtaaaataatttcacgtttcaaa
catataaaatatttggaagttagatggaaaagcacatattttttgacaactccgattttt
tacgttaatgctgaaccacacattggtcatttgtatacgactaccattggagatgccatt
tctcgttataaaaaattgaaaaattgtaatgttaaatacatggtaggaactgatgaacac
ggattaaaagttagtaaagcagccaaagctttaaatctaaatgttgaaacgttttgcgac
aacgtttcagaaaaatataaatcattatttaatgcatttgatattaggtataatgatttt
ataagaaccacagaaaaaaggcataaaaaaactgccatagaattatgggataaaatttca
tctgtagatttaatttacaaaggagaatattcgggatggtattgtgaagcagatgaaaca
tttatacctgaaaatgaattggaaccaaatgatgatccattggttaggtatacattaaat
gaaaaaaaaattgttaattatgttacagagcttaattataaatttaaattaagtaaattt
caaaatgatcttttacactggttagatagtggtgaaattataaaacctaataaatttcaa
aaaattttaagaaattggattgaagaaggaaatgttttaaaagatttatcaatatctaga
ccaactgaaagagtgtcatggggtattccagtaccaaaagatccgacacaaactttttac
gtttggtttgatgcattatcttcgtacttgagtactgatggatacccttattcaaatttt
aaatggcctccagatttacaaataatcggaaaagatattttaaaatttcatggagttttt
tggcctgcttttctcatggctgctggtttggaaccaccaaaatgtattttgtgtcacagt
cattggatgaaagataatatgaaaatttcaaaatcgacaggcaacgtaataaatcctttt
tcatatgcagaaaaatactcgagtgatggtgtcagatattatttattaaaagaaggagta
gctcacagtgatggaaattttaccgataagaaattaatagccatgttgaatgcagattta
gccgataaatttggtaatttattattaagatgtactagtttaacaataaatagaaatcaa
aaatatccttcgtttttaaaaggggatcgcaaaaggtttcatactacagattcagaaaat
ttaattaatgccctacaggatttgccagataaagtagacatgcattttgaagattttaat
ttttataaaggaatcgacgaaataataacgactttatctttaacgaataaatttttcgaa
tcggaaaaaccatggtacctggcaaataaatcagatgaatcagatcatttgaattatgtc
atacatttaacaatggaatcattaagggtttgcggcattctgctacaacccataatacct
aaaatatcggaaaatcttttaaataaactttcgataccgatttcgaaaaggaaaatattt
aacatcagaccattttcatgggagtgtgacggttcgacagagtcttacgatatatcacag
gataaaataatgcttttcacaaaaataaaaaattaa

DBGET integrated database retrieval system