KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM438100Help
Entry
Phum_PHUM438100   CDS       T01223                                 

Definition
(RefSeq) platelet-activating factor acetylhydrolase isoform 1B alpha subunit, putative
  KO
K16794  platelet-activating factor acetylhydrolase IB subunit alpha
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00565  Ether lipid metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    Phum_PHUM438100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phu03036]
    Phum_PHUM438100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM438100
Chromosome and associated proteins [BR:phu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Phum_PHUM438100
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM438100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A LisH Nucleoporin_N Ge1_WD40 Pox_A_type_inc
Motif
Other DBs
NCBI-GeneID: 8230610
NCBI-ProteinID: XP_002429541
VectorBase: PHUM438100
UniProt: E0VTU7
AA seq 410 aa AA seqDB search
MKMVLSQRQREELNKAIADYLSSNGYMDALQAFKKDADMPGEVEHKYGGLLEKKWTSVIR
LQKKVMELESKLSAAEKEIIEAPTRGKRTPSEWIPRPPEKFCLSGHRFPLTRVIFHPVFS
LMVSASEDATMKVWDYETGEYERVLKGHMNAVQDIAFDQTGKLLVSCSADLSIKIWNFQQ
DYECIKTLHGHDHNVSSVAFMPGGDYIVSGSRDKTIKMWEVASGYCIKTFTGHREWVRMV
RPSPDGTYIASCSNDQTIRIWIASTKECKLELREHDHVVECIAWAPESATSAINEAAGSD
NRRGAQKGPFLVSGSRDKTLKVWDISTGVCLFTFVGHDNWVRGVVFHPGGKYIISASDDK
TLRVWDIRNIRCFKKLEAHPHFCTCLDFHKSQPYAITGSVDNTVKVWECR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtgttatctcagaggcagagggaggagttaaacaaagctatagccgattac
ttaagtagcaatggatacatggacgctcttcaagcatttaaaaaagacgcggatatgcct
ggagaagtggagcacaaatacggaggactattggaaaaaaaatggacatccgttatacgt
ctccaaaaaaaagtcatggaattagaatcgaaattatcggcagctgaaaaagaaataatc
gaagctccaacgagagggaaaagaactccttccgaatggattcctaggcctcctgaaaaa
ttttgtctatccggtcatagatttccattgactagggtgatttttcatccggtgtttagt
ttaatggtgtctgctagcgaggatgctacaatgaaggtctgggattacgaaaccggtgaa
tacgaacgagttctaaagggacacatgaacgcagttcaagacattgcttttgatcagact
ggaaaacttttagtatcctgtagcgccgatttatcaatcaaaatatggaactttcaacag
gattacgaatgtataaaaacacttcacggacacgatcataacgtgtcgagcgtagccttt
atgcccggaggcgattacattgtttccggttcaagagacaaaacaattaaaatgtgggaa
gtcgcttcgggatattgcattaaaacgtttacgggacatcgcgagtgggtgagaatggtg
aggccgtctccggatggaacttacatagcatcatgttcaaatgatcaaacaatacgaatt
tggattgcgtccacgaaggaatgcaaattggaattgagagaacacgatcacgttgtagaa
tgcatagcttgggcacccgaaagtgcaacctcggctatcaatgaagctgccggatctgat
aatagaagaggagctcaaaaaggaccatttttggtttcaggctcacgtgacaaaacacta
aaagtatgggacatcagtaccggcgtatgtttatttacttttgtcggtcacgataattgg
gtgcggggagtcgttttccatccgggtggaaaatatataatcagtgctagcgacgataaa
actctgcgagtatgggatattcgcaatattagatgttttaaaaaactcgaagcccatcct
cacttttgtacttgcttagatttccataaaagtcaaccatatgcaatcaccggtagcgtc
gacaacaccgtaaaagtttgggaatgtcgttaa

DBGET integrated database retrieval system