KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM452910
Entry
Phum_PHUM452910   CDS       T01223                                 
Name
(RefSeq) hypothetical protein
  KO
K12841  calcium homeostasis endoplasmic reticulum protein
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Phum_PHUM452910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:phu03041]
    Phum_PHUM452910
Spliceosome [BR:phu03041]
 Complex A
  U2 snRNP components
   U2 related factors
    Phum_PHUM452910
 Complex B
    Phum_PHUM452910
SSDB
Motif
Pfam: CID Surp G-patch
Other DBs
NCBI-GeneID: 8230501
NCBI-ProteinID: XP_002429848
VectorBase: PHUM452910
UniProt: E0VUQ4
AA seq 805 aa
MDLPQPPNDVELRNIIDKLAQFVARNGPEFEQMTKNKQKGNPKFSFLFGGEHFNYYQYKV
TTEQAILKAKAARESIQQMSTQPPLPGAANNQPGLALIGSQTSFAGQGLNNSATPSNPTP
LQIINAAASATQWLVNHQQQAAVSNSGQLTLNSIIEQQSALNQQITQSEQNLAAQHAVLL
QNQQAQIEEAIRKTQAESLSKRAADHNVNLQDFDAILQPIIDSCTKDSISSGKAWILSKN
TPEAHQIVSQYLLSKVIAPGAPFSQKLHIIYLINDVMHHCVRKNAEGLKKSLEEVVVPMF
CSSSVSITEEHKAKLNKLINLWEVKNNYFSKEIIAKLKTPEKSWAEYQANLISQNVNIVN
SVTLATKASFENYQSQHQAFVNHALQQIQNLESQKIQFEQNNEVQNQFQVQQNSLNQVSM
MPNVMDHNLSNQPPVMSQPPPNLQDSQSLSSEVNIPMKFDAPPPLLIPNRIPLPIDNVNF
SQPPPTMFQHLPPDLIPDFSKPPPGFPTKENVMDDLIPSVPYFELPAGLMVPLIKLDDSN
YKPIDPDKIRLPPAVPPSERLIQAVEAFYQRNNSNTRERLILDADGWEKLGLYEYYKAKN
AAKKKKEEEIQDGLREKSRSPTPIKREKSRSRSPKKKRYRSKSRSKSREREKDRERDRSK
SSSRSPVRHHRSSNGKKSPRRSASSRSYKRSRSRSRSISPPSRNRSPTPPSFSGSNYGKP
LEQHLDESNKGHQMLKKMGWSGAGLGSKEQGIEAPIAGGEVRDKVDQYKGVGVNLHDPYE
NFRKSKGQAFITRMKARAEERMSSS
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggatttaccgcagccacctaatgatgttgaattacgcaacattattgacaaactagct
cagtttgtagctagaaatggaccagaatttgagcaaatgacaaaaaataaacaaaaagga
aatccgaaattcagttttttgtttggtggagaacattttaattattatcagtataaagta
actacagagcaggcgatattaaaagctaaagctgcaagagaaagcattcagcaaatgtct
actcaacctccattaccaggtgcagctaataatcaacctggattagcactgataggatct
caaacttcttttgctggtcaaggcttaaataatagtgcaacaccaagtaaccctactcca
ttgcagattattaatgctgcagcatctgcaactcagtggttagttaatcatcagcaacag
gcagcagtttctaatagtgggcaattgactttaaacagtataatagaacaacaaagtgca
ttaaatcaacaaattactcaaagtgaacagaatttggctgcccaacatgcagttttattg
caaaatcaacaagctcaaattgaagaagctattagaaaaacccaagctgaatctttgtct
aaaagagcggcagaccataatgtcaacttacaagattttgatgctatattacaacctatt
attgattcatgtacaaaagactcaatttcatcagggaaagcttggatacttagtaaaaac
actcctgaagctcatcagatagtttctcaatatttactcagtaaagtcatcgctcctggg
gctccattttcacaaaaattgcacataatttatttaattaatgatgtgatgcatcattgt
gtgagaaaaaatgcagagggcttgaaaaaatctttagaagaagtagttgttcctatgttt
tgcagttcatccgtaagcataactgaggaacataaagccaaattaaacaaactcattaat
ttatgggaagttaaaaataattattttagtaaagaaattattgcaaaattgaaaacgccg
gaaaaaagttgggctgagtaccaggccaatttgatttctcaaaatgtcaacattgtaaac
tcggtaactttagccacaaaagcatcatttgaaaattaccaatctcaacatcaagcattc
gtaaatcatgctttacagcaaattcaaaatctcgaatcgcagaaaatacagtttgaacaa
aacaacgaagttcaaaatcaatttcaagttcaacaaaattctttaaatcaagtttctatg
atgccaaatgttatggatcataatctttctaatcaacctccagttatgtcacaaccacct
cctaatctacaagattctcaatcactaagcagcgaggttaatattccaatgaaatttgat
gcaccgcctcctcttttaattcccaatagaatccctcttcctattgataatgttaatttt
agtcaacctcctccaactatgtttcaacatctacctccagatttaataccagattttagt
aaacctccgcccggatttcccactaaagaaaatgttatggatgatttaattccgtcagtt
ccttattttgaattgccagcaggacttatggttccattgattaaattagacgattctaat
tataaacccattgatcctgataaaattagactgccacctgctgtaccgccaagtgaaaga
cttattcaagctgttgaagcattttatcagagaaacaattccaacacgagggaaagactt
attttagatgctgatggctgggaaaaattaggtttatacgaatattacaaggcaaaaaat
gcagcgaaaaagaaaaaagaggaagaaattcaagatggtttaagggaaaaatcacggagt
cccacgccgataaaacgagaaaaatctaggagcagatcaccgaaaaagaaacgatataga
agtaagagtagaagtaaatcaagagaaagagaaaaagatagggaaagggataggtcaaag
tcaagttctcgttctccagttagacatcatagaagctcaaatggtaaaaaatcacctaga
agatctgcatcgagtaggtcttataaaagatccagatcaaggtctagatcaataagtcca
ccttcgagaaatagaagtcctacgcctcctagtttttctggttctaattatggtaaacct
cttgaacaacatcttgacgaatcgaacaaaggacatcaaatgcttaagaaaatgggatgg
agtggagcgggtcttggttccaaggaacagggtatcgaagctccaatagcaggaggagaa
gtcagagataaagttgatcagtataaaggagtgggagtcaatcttcacgacccgtatgaa
aattttagaaaaagtaaaggacaagcatttattaccagaatgaaagctcgagcagaagaa
agaatgtcttcatcttaa

DBGET integrated database retrieval system