KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM457140Help
Entry
Phum_PHUM457140   CDS       T01223                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit, putative
  KO
K03254  translation initiation factor 3 subunit A
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Phum_PHUM457140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:phu03012]
    Phum_PHUM457140
Translation factors [BR:phu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Phum_PHUM457140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 8230656
NCBI-ProteinID: XP_002429946
VectorBase: PHUM457140
UniProt: E0VV02
AA seq 1189 aa AA seqDB search
MARIGQRPENALKRANEFIDVGKPARALDTLSEVFRNKKWAYTWSESVLEPIMFKYLDLC
VELKKSVVAKEGLFQYRNMFQSVNVGSLENVIRFYLKTAEERTEIARNQSQQAVVDIEID
DLDNLATPESILLSAVCGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNVHVETLYHD
IARMTFQFCLKYNRKTEFRKLCDKLRKHLEDIGKLAPQVANVSISKPETQQLNLETRLYQ
LEYAIQMELWQEAYKAIEDIHNLMSLSKKSPMPKTMANYYQKLALVFWKAGNYLFHAAAL
FKLFQLSKEMKKNMSAEELQRMACRVLLATLSIPLPSAHPEFDRFIETDRSPLEKVQRLA
TLLGLSQPPTRASLLKDIIRVNVVNLASKQLQDLYSWLEVEFHPLLLCERVQTVIEVLQS
EESSSLQQYIPALQDVTLVRLIKQVAQVYQTIELSRMMQLAKFTDAFHLERLLVDCVRHN
DMQIRIDHGAKCIRFGIDLSEAQREDKPEGPTLQCMPSEQVRNQLVNMAAVLHKAMATIN
PNKKKLEREKLRAKMVQQYHESKISEHERILKRHKIIEDRKEYIERKNTQREEEEMRRQE
HIQRQLLLQEQKRLEAEREERERRRQENEIQQIRDRHLKERMQAISQTAHGQKILKKLDE
DDMKKLDAEQIAAKEQEEIQKEKREMQQKLKTQEKRVDYFERAKRLEEIPLLEKAFEEKQ
VQDKALWEQREKERIEKLIEDRELAVKCAERLKRMADDKNAFLEKLKSERKNVYLEKLKD
FEKRLDEERKKRLAERRQRRKEERREKQAAAEKKRLEEEERRKQREEEEKQEKLRKMRED
ELYRKEKEKKDHQAEIQRAREEEAERKRLEEEKKFKDYEPWRSEKEPRFRDDRRDRDPDR
NRDRERERDRDRDRDRDRDRDRDRDRDRDRDKDRDRDDGNDDMNWRRGGGPLKDEPKKVE
SWRPPALRNRGAENRNMDRESKPADISENWRSGSRAEPSDRFNRDRMRDRDRDRDRDRDW
DRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRNRNGRDSGPPMSWRNKEGPDRGDRDRDW
DRDRDRDRDRDRDRERDRDRDRDRDREIGRERDRDRDRDRDRGGERGPMRRDDHMRHDRR
DDWRSSARDEPRGTPTKSRDGGGYKDDSRGMGRDGPRDHSQREEKKGGE
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaatcggacagcgaccagaaaatgctctgaagcgagccaatgagtttattgat
gtggggaaacctgctcgagcattagacacgctttcagaggttttccgaaataaaaaatgg
gcttatacatggagcgaaagtgttctggagcccataatgttcaaatatttggacttatgt
gtggaactaaagaaatctgttgtagccaaggaggggctatttcagtacaggaatatgttt
caatccgtaaatgtcggttccttagaaaatgttatacgattttatttgaaaacggctgag
gagagaactgaaatagcgagaaaccaaagccagcaagctgttgtcgacattgaaatagat
gatttagataatttagccactccagaaagcattcttttaagtgctgtatgtggagaggat
gctcaagatcgtagtgacagaaccatcttaactccttgggtaaaatttttatgggaatcc
tattgtcaatgtctggagctcttaagaactaatgtgcatgtggaaacattataccacgat
atagcaagaatgactttccaattttgtttaaaatacaatagaaaaacagaatttagaaaa
ttgtgtgataaattaagaaaacatttggaagatattggaaaattagcacctcaagttgcc
aatgtttctatttcaaaaccggaaactcaacaattgaatttggaaactcgattgtatcaa
ttggaatatgccattcaaatggaattatggcaggaagcttataaagctattgaagacatt
cataatctaatgagtttgtccaaaaaatctcccatgccaaaaacgatggctaattactat
caaaaattggcattggtattttggaaagctggtaactatctttttcacgcagcagcccta
ttcaagctttttcaattaagtaaagaaatgaagaagaacatgtcggctgaggaattacaa
aggatggcctgtcgtgtattattggcaacgctttccattcctttaccttctgctcatcca
gagttcgatagattcattgaaacggatcggtcacctttggaaaaagttcaaagattggct
acgcttttgggattatcacaaccccccacccgggcctcacttcttaaagacattattaga
gtgaacgtagtaaatctggcatctaaacagcttcaagatttatattcttggttggaagtc
gaatttcatcctttgcttttatgcgaaagagttcaaacggttattgaagtacttcaaagt
gaagaaagttcttctcttcaacaatacataccagctcttcaggatgtaactttagtccgt
cttattaagcaggtggctcaagtttatcagacaatcgagttatcaagaatgatgcaactt
gctaaattcacagatgcctttcatttggaaagactgcttgttgattgcgtacgccataat
gatatgcagataagaatcgatcacggagccaaatgtattagattcggaatagatttgagc
gaagctcaaagggaagataaaccggagggtcctacccttcagtgcatgccctcggaacaa
gttcgtaatcagttggtcaatatggcggcagttcttcacaaagctatggcaacgataaat
cctaataaaaagaagttggaaagagaaaaacttcgagctaaaatggttcaacaatatcac
gaatctaaaatttcagaacacgaaagaattctcaagcgccataaaattatcgaagataga
aaggagtatatagaaaggaaaaacacgcagagggaggaagaagaaatgcggcgtcaagaa
cacattcaacgtcaattattacttcaggaacaaaagagacttgaagcggagagagaggaa
cgagaaagaagaagacaagaaaacgaaatccaacaaatccgcgacagacacttgaaagaa
agaatgcaagccatttcccaaacggcacacggtcaaaaaatattgaaaaaacttgacgaa
gatgacatgaaaaaattagatgctgagcaaatagctgcaaaagaacaagaagaaatacaa
aaagaaaagagggaaatgcagcaaaaattgaaaactcaagagaagagagttgattatttc
gaaagagcaaaacgtttggaagaaattcccttgttagaaaaggcctttgaagaaaaacag
gttcaagataaagctttgtgggaacaaagggaaaaagaaagaattgaaaagttgattgaa
gatcgcgaattggccgtcaaatgtgcggaaagattaaaaaggatggccgatgacaaaaac
gcattcttggaaaaacttaaatccgagaggaaaaacgtttatttggaaaagctcaaagat
tttgaaaaacgtttggatgaggaaaggaagaaacgtttggccgaacgtcggcaacgtcgt
aaagaagaaagacgtgaaaaacaagcagcagctgagaagaagagattggaagaagaagag
agaaggaaacaacgtgaggaagaggaaaaacaagaaaagttgagaaaaatgcgtgaggat
gaattgtacaggaaagaaaaagaaaagaaagatcatcaagcagaaatacaaagagccagg
gaagaagaagcagagcggaaaagattggaagaagagaaaaaatttaaagattacgaacct
tggagaagtgaaaaggaaccgaggttcagagatgatagaagggatcgagatccagacagg
aatagagacagagaacgggagcgagatcgtgatcgtgaccgtgaccgtgatcgagaccgc
gaccgcgatcgagaccgtgatcgtgatcgtgacaaagatagagatagagatgacggaaac
gatgatatgaattggagaaggggtggaggacctcttaaggatgagcctaaaaaggttgaa
tcgtggaggccaccagctcttcgtaatcgcggggcagaaaaccgaaatatggatagagag
tcgaaaccggctgatatttctgaaaattggagatctggatcacgagctgagccttctgat
agatttaatcgcgatagaatgagggatagagacagggacagagacagagatagagattgg
gatcgcgatcgtgacagagatcgtgacagggatcgcgatcgggatagagaccgtgataga
gatcgcgatcgcgatagggatcgtgatagagatcgtaataggaatggaagggattcgggg
ccaccgatgagttggagaaacaaggagggccctgatagaggagacagagaccgtgattgg
gatagagacagggatagagatcgtgatcgtgatcgcgacagagagcgtgatcgggaccga
gaccgagatagggacagagagataggcagagaacgcgaccgcgaccgcgatcgtgatcgt
gaccgtggaggagagagaggaccaatgcgtagagatgatcacatgagacacgatcgacga
gacgattggcgtagttcggccagagacgagcccagaggaactccaacaaaatcaagagat
ggaggaggatataaagatgattcgagagggatgggaagagacggtccaagagatcattct
caaagagaagaaaaaaaaggtggtgagtag

DBGET integrated database retrieval system