KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM459220
Entry
Phum_PHUM459220   CDS       T01223                                 

Definition
(RefSeq) succinate dehydrogenase, cytochrome B small subunit
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00020  Citrate cycle (TCA cycle)
phu00190  Oxidative phosphorylation
phu01100  Metabolic pathways
phu01200  Carbon metabolism
Module
phu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phum_PHUM459220
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Phum_PHUM459220
SSDB
Motif
Pfam: CybS
Other DBs
NCBI-GeneID: 8230960
NCBI-ProteinID: XP_002430019
VectorBase: PHUM459220
UniProt: E0VV75
AA seq 187 aa
MIKFSFRQKIFSFFFFFIAHVLKNQFSNVKVLAFANLHHFTTTSQNSLIKYKASNVSSKP
SILTLPVFKNISTSSPKLAGHSKHDHSKLWSLERLMSLVLLPLVPAALVYPCQALDTALA
VLIVMHTHFGLEAIVVDYVRPILFGNLIPKISHGLLYLFSIVTLAGLLNLIFNDCGLSNA
ILTVWKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgattaagttctcttttagacaaaaaattttttcatttttttttttttttatagctcat
gttttaaaaaatcagttttcaaatgtgaaagttttggcttttgctaatttgcatcatttt
acaaccaccagtcaaaattcattaattaaatacaaggcttcaaatgtttcttcaaagcca
tcaattttgaccttacctgtatttaaaaatatatcaacatcatcaccgaaattagctggt
catagtaaacatgatcacagtaagctatggagtcttgagaggttgatgtcacttgtttta
ctaccacttgttcctgcagctctagtttatccctgtcaagcattagacactgctttagct
gtacttattgtaatgcacactcattttggtttggaagccattgtggtggactatgttcga
ccgatactttttggtaatttgatacccaaaataagtcatggattattgtatttattttca
atagtcactcttgcaggattattaaatctcatatttaatgattgtggattgtctaatgct
attttaactgtatggaaaaaataa

DBGET integrated database retrieval system