KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM498310
Entry
Phum_PHUM498310   CDS       T01223                                 

Name
(RefSeq) tyrosine-protein phosphatase corkscrew, putative
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM498310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phu01009]
    Phum_PHUM498310
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     Phum_PHUM498310
Protein phosphatases and associated proteins [BR:phu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    Phum_PHUM498310
SSDB
Motif
Pfam: Y_phosphatase SH2 SH2_2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 8236223
NCBI-ProteinID: XP_002430772
VectorBase: PHUM498310
UniProt: E0VXC8
AA seq 622 aa
MIIIIHHLVGWFHPNISGVEAETVLLERGFDGSFLARPSRANPGDFTLSVRRNGEVTHIK
IQNTGDFYDLYGGEKFATLSELVQYYVENQGQVREKNGQVIELKYPLNCADPTPERWFHG
HISGKEAEKMILEKGKNGSFLVRESQSEPGHFVLSVRTEDRVTHVKIRCQENKYDVGGGE
RFESLSELIEYYKKNPMVETSGTVVHLKQPFNATRINASGIDTRVKELQKENGAATGKAG
FWEEFESLQQQECRHLFTRKQGQRPENRNKNRYKNILPFDHTRVKLKNADPNIPGSEYIN
ANYIRQEPQEGSGLAGSEVGLKSYIATQGCLPSTVADLWMMVWQENVRVIVMTTKEIERG
KNKCARYWPDKNQSKEYGPIKVCSVSETSTSDYTLRQFLVSSEEGTEQKTIYHYHFQAWP
DHGVPSDPGCVLNFLHDVNARQESIPDAGPVLVHCSAGIGRTGTFIVIDMILDMIKRQGP
DCEIDIQRTIQMVRSQRSGMVQTEAQYKFVYLAVQHYINTLTQRIQAEQKSLQLGREYTN
IKYTECKVNDGGGSGGSSCGGSKTQIDLPRPPEDLPRQMYENLPLKERGHNNVGASPGPT
AGTRSPTSATSPPTPAPRNCIY
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgataataattattcaccatctggtggggtggtttcatcccaacatatctggtgtcgaa
gcagaaacagtactattggaaagaggtttcgatgggtctttcctagcaaggccaagtcga
gccaatccaggggattttacattatctgtaaggagaaatggagaagtgactcacataaaa
attcaaaacactggagatttttatgatttgtatggaggagaaaaatttgcaacactttcc
gaattggttcagtattatgtggaaaatcaaggtcaggttcgtgaaaaaaacggtcaagtt
atagaattgaaatatccgttgaattgcgcggatccgacgccggaaaggtggtttcacggt
cacatttctggaaaagaagcggaaaaaatgatattggaaaagggtaaaaatggaagtttt
ctggtacgagaatcccagagcgaaccaggtcattttgttttatccgtcagaacggaagac
agagtcacacacgttaaaattagatgtcaggagaataaatacgacgtcggaggcggcgaa
aggttcgaatccctgagcgaactaatagaatattacaagaaaaatccaatggtcgaaaca
agtggaacggttgttcatttgaaacaaccttttaacgcgacaagaatcaacgcttccggc
atagacacgagagtcaaagaattacagaaggaaaatggtgcggcaactggaaaagctgga
ttttgggaagaatttgaaagtttgcagcagcaagaatgtagacatttattcacaagaaag
caagggcaaagacccgaaaacagaaacaaaaatagatataaaaatattttgccattcgat
cacacgagggtgaaattaaaaaatgcggatcccaacattccgggttccgaatacataaac
gcgaattacataaggcaggaaccgcaggaaggttcgggtttggcgggttccgaagtcgga
ctgaaatcatatatcgcaacgcaaggttgtttgccgagcacggttgccgatttgtggatg
atggtctggcaggaaaacgtcagagttatcgttatgactaccaaagaaatagaacgggga
aaaaataaatgcgccaggtattggccggacaaaaaccaaagcaaagaatacgggccgata
aaagtttgcagcgtgagcgaaacatcaacaagcgattacacattacgtcagtttctagtc
tcatccgaagaaggcacagaacagaaaaccatttaccattaccactttcaagcctggccc
gaccacggcgtgccctctgaccccggctgtgttctcaattttttacacgacgtgaacgct
cgtcaagaatccattccagatgcgggccccgtactcgttcattgttcggcgggaatcggg
agaacgggaacgtttatagttatcgacatgatattagacatgatcaaaaggcagggtccc
gactgtgaaatagatattcaaagaacaattcaaatggttcgttcgcaacgttctggaatg
gttcaaactgaagcacagtacaaatttgtttacctagccgtacagcactatataaatacg
ttaacgcaaagaatacaagccgaacagaaaagccttcaattgggtcgagaatacacgaat
ataaaatacacagagtgcaaagtcaacgacgggggagggagcggtgggagcagttgcggg
ggaagtaaaactcaaatcgatcttccaaggcctccggaagatttgccacgacaaatgtac
gaaaaccttccgttaaaagaaaggggtcacaataacgtgggagcgtcaccgggtccgacg
gcgggaactcgatctccgacttctgccacgtctcccccgactcccgcccctagaaattgc
atttattaa

DBGET integrated database retrieval system