KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM514080Help
Entry
Phum_PHUM514080   CDS       T01223                                 

Definition
(RefSeq) Flavin reductase, putative
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00740  Riboflavin metabolism
phu00860  Porphyrin and chlorophyll metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Phum_PHUM514080
   00860 Porphyrin and chlorophyll metabolism
    Phum_PHUM514080
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Phum_PHUM514080
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     Phum_PHUM514080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 8233147
NCBI-ProteinID: XP_002431163
VectorBase: PHUM514080
UniProt: E0VYG9
AA seq 210 aa AA seqDB search
MSKMEKLAMFGATGMTGICALKEALDLGFKVKLLLRDPSKLPSEYNDKVEIVKGDVTNLE
DVKKTVSGVDGVVVVLGTRNNLEPTTDLSNGLKNIVHAMKENNIDVISVCLSAFLFYDLD
KVPPVFKDINEEHGRMLDVLKSSNLNYIAVFPPHIADNPKSEYIVKNDASPGGRVVSKYE
LGNFLVTSLKMEQHYKKIVGICSVSSMPKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatggaaaaattggccatgtttggagcaacaggaatgaccggtatttgtgca
ttaaaagaagcattggatttgggttttaaagttaaattacttcttcgagatcctagcaaa
ttacccagcgaatataatgataaagtggaaattgttaaaggagatgtcaccaatttggaa
gatgttaaaaaaacagtttctggtgtcgatggtgtcgttgttgttctaggaacgagaaat
aatttggaaccgacaacagatttatcgaatggtttgaaaaatattgtgcatgcaatgaaa
gaaaataatattgatgtcatatctgtttgcttatcagcatttttgttttatgatcttgac
aaagttcctccagtatttaaagacattaatgaagaacatggaagaatgttggatgtgctc
aaatcgagcaacttgaactacattgcggtatttcccccccacatagcggataatccaaaa
tcggaatacattgttaaaaatgatgcatctcctggtggaagagttgtatctaaatatgaa
ttgggtaattttttggtgacaagtttaaaaatggaacaacattataaaaaaattgttggc
atttgttcggtgtcatcaatgcctaaacaataa

DBGET integrated database retrieval system