KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM518550
Entry
Phum_PHUM518550   CDS       T01223                                 
Name
(RefSeq) Inactivation-no-after-potential D protein, putative
  KO
K13804  inactivation no afterpotential D protein
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Phum_PHUM518550
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 Tricorn_PDZ MPDZ_u10
Other DBs
NCBI-GeneID: 8233266
NCBI-ProteinID: XP_002431281
VectorBase: PHUM518550
UniProt: E0VYT7
AA seq 560 aa
MADLFITYYTSFQKHTNFIFNEGFKKNTSRKVKKKYGNLGDTILVINLEKSHRGLGISLA
GHKDRNRMAVFVCGINPNGPAFKTGGIKVGDEILEVNGIVLQGRCHLNASAIIKGLPGPT
FKVIILRRASALEDLAVKPITQFPLTLDDEQKYAKFKGVKTITIKKGNQNLGIMIIEGKH
AEVGQGIFISDIQEGSSAEQAGLTVGDMILAVNKDTLLGTNYDSAATLLKKTEGLVTLVI
CNPNKGREEEKTVMGSLEPKGTGGHTPNRSPTPVQKEPEKSRLIPFTNLKPLKSSSSPSK
QLFDVGGSGTINESQISNFVLTAPTTLVPTATITPKTSPALSTRKCTSNTKIPEEPLPDP
ATCPIIPGKEILIEINKDKLGLGLSIIGGCDTLLGAVIVHEIYPESAAEKDGRLEPGDQI
LEVNSEDVTKMPHSKVLTVMRQTQAKVKLLVYRDENITKENLLQTIDVDLIKKPGKGLGL
SVAAKKEGKQVFISEIVHNGIAELDGRLMKGDYILEVNGISLKESNQEIAAAVLKSCTGK
VAIKVGRITCKKHVNNINGR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggcggatttatttattacctattacacatcatttcaaaaacatacgaattttattttt
aacgagggatttaaaaaaaacacgtcacgaaaagtgaagaaaaaatatggaaatctcgga
gatactatattagtgattaatttagaaaaaagtcatagaggtttaggaatcagccttgca
ggtcataaagatagaaatcgaatggccgttttcgtatgcggtatcaatccaaatggtcca
gcatttaaaacgggaggaatcaaagttggagatgaaattttagaggtgaacggtatcgta
ctccagggaagatgtcatttaaacgcatccgccataataaaaggattgcctggaccaacg
ttcaaggtcatcatactccggagagcgtcggcattagaagatttagccgtgaagccgatc
acacaatttccattaacgttagacgatgagcaaaaatatgccaaatttaaaggagtcaaa
acgatcaccattaaaaagggaaatcaaaacctcgggataatgattatcgaaggaaaacac
gccgaagttggtcaaggaattttcatttcggatatacaagaaggaagttctgcggaacag
gctggtttaaccgtcggtgatatgattctcgccgttaataaagatacattattaggaacc
aattatgattcggcggcgacattgctcaaaaaaacagaaggattagtgacgttggttatt
tgcaatcccaacaaaggaagagaagaagaaaaaaccgtcatgggaagtttggaacccaaa
ggaacgggtggacatactccgaacaggagtccgactccagtacaaaaagaaccggaaaaa
tcgaggttaataccgtttaccaatttgaaaccgttaaaatcttcttcgtcgccatcgaaa
caattattcgacgtcgggggatccggtacgattaacgaatctcaaatatcaaattttgtt
ttgacggctccgacgacactcgtaccaactgcaacgataaccccgaaaacatcacccgca
ttatcgacacgtaaatgcacgtcaaatactaaaattccagaagaaccacttccggatcca
gcaacatgtccgataattccaggaaaagaaatccttattgaaataaataaagataaattg
ggattaggattaagcataattggaggctgtgacactttgcttggagccgtgatagttcac
gaaatttatccagaaagtgcagctgaaaaagatggaagactggaaccgggagatcaaatt
ttagaagttaattctgaggatgtaactaaaatgccacattcaaaagttctcacggtcatg
agacaaactcaagccaaagtaaaattattagtttatcgagatgaaaatataaccaaagaa
aatttactgcagacgattgatgtcgatttaattaaaaaacctggaaaaggtttgggttta
agcgtggcagcaaaaaaagaaggaaaacaagttttcatatccgaaatcgtacataatggt
atagcagaattagatggaaggttaatgaaaggtgattacatattagaagtcaatggtata
tcattgaaagaatcaaatcaagaaattgctgcagccgtattaaaatcgtgtactggaaaa
gtagccattaaggtcggaaggataacgtgtaaaaaacatgttaataacattaacggaagg
taa

DBGET integrated database retrieval system