KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM541090Help
Entry
Phum_PHUM541090   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM541090
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM541090
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:phu04812]
    Phum_PHUM541090
   04147 Exosome [BR:phu04147]
    Phum_PHUM541090
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Phum_PHUM541090
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Phum_PHUM541090
Membrane trafficking [BR:phu04131]
 Others
  Actin-binding proteins
   Others
    Phum_PHUM541090
Cytoskeleton proteins [BR:phu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Phum_PHUM541090
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM541090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set BiPBP_C C2-set_2 Ig_6 Receptor_2B4 V-set_CD47 CreA
Motif
Other DBs
NCBI-GeneID: 8235648
NCBI-ProteinID: XP_002431694
VectorBase: PHUM541090
UniProt: E0W000
AA seq 4792 aa AA seqDB search
MSQTQQFSVSGRLSMSASPPVFEQIFRNARFAQGGNALFEGKIRGNPKPTVTWTRKGAPL
LESNKFKMTYEEQTGNVTLLINKIGPGDEGEYTCTARNQYGEAICSVYIQPEGTMMPQQT
YQPQGFQREVSQTFDTAEHKTSTTYQKFQQQQKTEKYGYSNGVYTNGHSAIEDFKVDTFE
YRILREVVFRNSLTRRYQGESDAQISQTVDMSLGPAASPQFSQKPRNSKLGEGTDATFQA
KVSANPRPRLTWFKNGQRIMSSDKYNINFANQTATLNVKNVTADDCGHYTLLAENPQGCV
VSSAYLAVEPSADNYIESQVLKQTQMESAASYESDSSKSLAPNFIRTCSDRDAQEGKMTR
FDCRVTGRPYPDVTWFINGRPVSDDSTHKILVNESGNHALMITNVNRNDHGVITCVAKNK
AGETSFQCNLNVIEKELVVAPKFVERFTTVNVKEGEPVVLNARAVGTPVPRITWQKDGVQ
ILPGPNVCIMTEGGASTLEIANAKASDAAWYQCTAQNVAGSTATRARLFVETPKFVQEAE
PKRLNLPKPTRVIEPELEAGPEVIYLRHVERSKRHRRHQDEEKVYPPPQFIIPLKDANSH
EGGKVHFEGRIEPVGDPTMRVEWYINGRPLTASSRARTTFQFGYIALDLLSLIFEDTGEY
LCRVVSSTGVAESRGILRVTERPAIELSSQHPDSLQQIQQLEDYSKYQRTQSMEEIIGQK
PVFIRPLKNLGELQEGRNAHFEAQITPVSDPTMKVEWYKDGRPITASSRISTIFNFGYVS
LNIMQLRPEDAGQYVVKAVNRLGEAVSTSDLRVFVRQSVTGDSGIPEQQRYIDKTMELEA
YQLQQQYKPVPAGPPESTEPPVFKSPIKDQINIKEGAFAHFEARLEPLNDSTLKVVWLKD
GKPVEASSRITSFFNFGYVALTIKYVTSRDVGVYTCKAYNQLGEAQTTAQLTVLGKQDII
FDSQHPGGLQKIQNLEDSSRYERMVKEEQSVTQKPRFLGPLKGTNKIVEGQRAHFEARVE
PQNDLTMNVEWYHNGKPLQTANRTQTYHDFGYVALDITSVRSEDAGSYTVVAKNKLGDAQ
ASTTMEVETRSSIDTTSMHHGLYEKTKRLEDSKFVEPHYDIEEISKSKPIFTQPLSDPKP
VFEGKNIHLECRLEPMGDPTMRVEWYCNGRPVTVGSRFRTYYDFGYVALDIIQAQAFDSG
EYTVRATNHLGSAHTSACVRVIGRSDVVTESQNEAALEQIQMLEDSSRHRRHVQEDITIV
QPPQFTRPLHNLETIEGTNIHLECRLQPVGDPNMRIDWFVNGRPVKTGHRFKPAYDFDYV
ALDLLSVYPEDSGVYTCQARNQLGEAVSSCSVKIIAKKDLILESQHPSGLEKIQYLEDAS
RYKRSEVTDEVVKMKPKFTTKPKSLENMREGRHAHFECKLEPVTDSNLKVEWYKNGRPIT
VGHRFRPIHDFGYVALDIIDLITEDSGIYTCRATNMLGMDETTCSLQCLGSSAILTSSQN
EIGYEKIQHLEDKSRYQRAEFVEEVTKQSPTFTTSLKNIDIKEGQRAHFECRLIPVSDPT
MKVEWFHNNVPLKSGSRFTETNSFGFVALDILHSQPEDSGTYTCRAINALGEALTSAQLN
TSSRKSIYLESQHEGALDKLSYLEDESRHRRHTQQEEVVSQPPVFTMPVKDLKVAENQAA
HFEARLIPVGDSRLKVEWLRNGVPIAASNRIATMHDFGYAALNMKYVYPEDSGTYTCRAV
NDLGEAVTSATLVCQSKASLLLESQHEEALEKLRALEAGRPQQRETEEIIVTEAPRFVAQ
LNGPNNLYEGQSAHYECRIEPYPDSNMKVEWFCNGKPLQTGHRYRTTYDFGFASLDVLGV
YPEDSGEYTCKATNKLGTAQSSTTLKVTGRSSIISETQHEGAMQKIQYLEDDSRYKKTDR
EDVVTIEKPQFGRGLNNIDRLPEGKSAHLEATLTPINDSTMKVEWFHNGKPIKQGHRFKT
TYDFGYVSLDILYAYPEDSGTYMCKARNAVGEAVTTSSVTVDSKAGLDLNTMDAERLRKL
KELESYQRPTKAELEPERRKPVFTTALNNLENVKEGEHAHLECRVEPIDDANLKIEWFVN
GVPIKTGHRFRTTHDFGYVALDILYTYAEDSGNYMCKATNDLGEAVNTCSVKCSSRKSIY
LESQHPDGLQKIKELESQSYYTKPEVEELPITPPRFVSDLRGTTEVMEGGTAHFECQVEP
LHDANLRVEFYHNGKPLPSASRFHITFDFGYVALDITHCVPEDAGEYTAKAINSLGECTS
SINLKVVPKSSIISESQRPEGLEKIRKLEEQTPFQRPEEPEPITKQRPVFTQPLQNIDSI
NESGTAHFECRLIPVGDPTLKVEWYRNEKLLENSSRITKTHDFGYVSLDMTHVRPEDEGV
YMCRASNPLGEAVTTASMVVKSKASIQLDTQHPEGMKRIQKLEQKAPQRAEEPEKAFDKP
IFTQLLTGPSELWEGQHAHFECRVVPVGDPTLRLEWFVNGVELKMGSRFRVNHDFGFVTL
DINSTVTEDSGVYMCKAINSVGEAVTSTSLKVKPKSAIVGDALHPDAWQKIQLKEAEMNK
VPAKFVDTAPQQAPVFTKHLQSFEKLVEDQQVFLEAQVEPRTDPNLRIEWFKNGEPLATG
SRIKGTFDFGLVTLTVNNLRADDSAIYTCKATNLLGEAVSTCTLKIEDKDWLMAHTLHPD
ALPRLAALEQVPTKKSEAPEPVFESPAFITHLNNIECLEGDNVRFECQVEPSKDPTLKID
WFVNGKTLPMGSKYKSSYDFGQVALDISHCYGEDSGMYTCRATNSKGQATTSGTLKCVGK
QSIYRDTQHPMGKAGLEQVQKIDDITAGKYQRQESAPEAEFQKPIFVVPLPQENKVGEGE
PLRLECQVEPKDDPNLKIEWYLNSKALDHGSRFKMTNDFGYVALDLMDVYERDQGIYTCK
AWNKAGEAYTSTTLYCVGKDGLIESTQHPKGKEGLEKIQDLEESMKRPDSKPVAPEDGQA
PQFTSQFQQLSNLSEGDIAHFEASLTPVGDQTMVVEWFYNGKLLEASHRTRTVYAFGMVM
LEILGTKIEDSGVYTCRATNKWGQDEISVNLECVDKSKGQKPRFTTHIQNIDNLKEGQAA
HFECTLVPVGDPNMKVEWFHNGEPLRHSSRIKHVSDFGYVVMDISYAQSHDTGEYICKAS
NKFGEDYTKATIKCTGKSGVFFDTLQPDSLAKIRELEAYTAASGTQTPQAPITEPPKFIT
QISDITQLKEGQSAHFEARLVPVNDPNMVVEWYCNGKKLPHGHRYRTFHDFGIVILDILY
CYEENSGVYECRATNKCGSDMTKASLKCFSKTNLILDSQLPRGMEGGLEKIQNLEDSHAK
SRDEKTVETKGMAPVFTVPLSNINDLKEGESAHFEGRLIPTDDPKLKVEWFWNGKPLKTG
SRFRTFCDFGFVILEIAPVYPEDAGEYSCRATNDYGEAVTIAQMNVQGKRSIILESQLPK
GMERTIDKIAELEGLGQMQGPSTPDESLGKPPEFITTPEDLTLGENSSAHFECRLTPVND
PSMRVEWFHNGKALSAGSRIRTINDFGFVILEIDGVYFRDSGLYTCKATNKHGEATVSCQ
LQVRGRTGIDLEPQLPSQFKTGTESLQKLEESLNKKEEILPSEETPNPPKFIVELKDCLN
AQEAKSVHFECRVEPTNDPTMRIDWFHNGKPFATGSRVHMLNDFGFIVLDMDYVYARDNG
EYVCRATNKWGSATTKATLMCKDQHNIILDSQLPQGMTGEKLKDLEKGQGTTPLPEDAPG
QPPKFITQIESVSTTEGEPVHFECRVEPKNDPHLNVEWYHNGKLLKAGHRFRTLFDLGYV
SLTLINVYPEDAGEYVCRAYNKLGEDFTKASLACKKTSSIILQNQVPKGMKKSEALMQME
ASIKKYTSEIFLTEDDLYEPEKRQPPRFVTQIKENLELVERDVFKFECQLAPVGDPNMKV
EWFFNGKPLLHKNRLHPIYDFGYVALNFEWVYPEDSGEYLCRATNLYGQDETRAVIKIAG
KPSIIYDSQLPKGMKSIEKIREMEAGWQQYRETKEEEVKEKEPPQFVTKPEPFVVVEGDT
ARFCCRVTGYPRPRVMWLINGKTIVNGTRTKITYDGMWHLDIPKTRQYDNGKIEVIAKNS
CGEAVCDTTLTVKPRGDDYRNVLKNSPRPWYDIELTGYQKERQETELEKMFEERNQTERN
FEPEHLRKKEIKEPETEWQKNVKSKKSDDYYGKLRELEEEQIIKESKIRETSHQFAIPGE
KVSRKSLAKGMAKSYEESLEKEEPVLEWQQKAKERSRRLKTEYDETETETVEGTDKRRGV
RGVPEPSESTVHGKEVHVSKQRQKQKEIQGDLEITRNISATETTEVEHKATTHERVVDGP
VKPAKAPFFTKKIQPCRAFEQEQARFEVEYDGDPMPKVKWFRENQLINNSPDFQIHTFGT
KSVLILRQVFLEDSGVFSVIAENRGGTAKCSANLVVEEKRKTGRGGTIPPNFLTTIQSCV
VPAGQLARFDAKISGTKPLDVYWLKDGQKVLPDIRFKVLEEDNTYTLLIIEAAPEDSGTY
ECVAINSSGEARCEAECVVQAPASRKTPLKTPPSPGVERKPTLMEQLKSQIVKEGQSVSF
RCKISGRPSPEIQWFKGENLIKPSKYFQMQKEGDWCTLRITEAFPEDEGPYKCVATNPGG
SVSTTANLKVTAPDSKEKAPHLNPMKDVTVQEGSPAQFRTKVTGVPQPTIQWLREGMLIP
QTADFQMIQEGNNVVLLIATTYEEDTGIFTCRATNSAGQSEVSARLTVKSKN
NT seq 14379 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacgcaacaattttccgtaagtggcagactttcaatgagcgcttcgccaccg
gttttcgaacaaattttccgaaatgcaaggttcgctcaaggaggcaacgcacttttcgaa
gggaaaatacgcggaaatcccaagccgactgtcacgtggacgagaaagggagctcctctc
cttgaaagtaataaatttaaaatgacgtacgaggaacaaacagggaatgttactctgctc
attaataaaatcggacctggagatgaaggagaatacacgtgcacggctagaaatcaatat
ggagaagccatttgctccgtgtacattcaaccggaaggtacaatgatgcctcagcaaacg
tatcaaccgcaaggcttccaaagagaagtttcacaaactttcgatacggccgaacataaa
acgtctacgacatatcaaaaatttcaacaacagcaaaaaacagaaaaatatggttatagt
aatggagtttatactaacggacactctgctattgaagatttcaaagttgatacatttgaa
tatagaattcttcgagaagttgtgttccgtaattcgttgacaagaagatatcaaggtgaa
agtgatgctcaaatttcacaaactgttgatatgtctctcggacctgccgcatcaccgcaa
ttttcacaaaaaccacgtaattctaagttgggtgaaggaaccgatgctaccttccaggca
aaggtttctgctaatccccgacctaggttaacttggtttaaaaatggtcaaagaattatg
tcatctgataaatataacataaactttgctaatcaaacagctactcttaacgttaaaaat
gtcaccgctgatgattgtggtcattacactcttttggctgaaaatcctcaaggttgcgtt
gtatcttcagcttaccttgcagttgaaccgagtgccgataattacattgaaagtcaagtt
ttaaaacaaactcaaatggaatctgcagcatcttacgaatcggacagtagcaaatcactt
gctcccaactttatacgcacctgctctgatagagatgcacaagaaggaaaaatgacacgt
ttcgattgtagagtcaccggtcgaccgtatccagatgtgacttggtttattaacggtaga
cccgtgtcagatgattctactcataaaatattagttaacgaatctggaaatcatgctctt
atgattaccaatgttaatagaaacgatcacggtgtcataacttgcgttgccaaaaacaaa
gccggagaaacttccttccagtgcaatttaaatgtcattgaaaaagaattagtcgtagct
cctaaatttgttgaacgtttcacaacagtcaatgttaaagaaggagaacctgttgttttg
aatgctagagctgttggaactcctgttccacgaatcacttggcagaaggatggcgtgcaa
attttacccggcccaaatgtttgcataatgactgagggtggagcttcgacgttagaaatt
gcaaatgcaaaggcgtcggatgctgcatggtatcaatgcacagctcaaaacgtcgctggc
tccacagcaactcgcgcgagactttttgtagagactcccaagttcgtgcaagaggcagaa
cctaaacgtcttaatttaccaaaacctacaagagttattgaacccgaacttgaagctggt
cctgaagtgatttatctaagacacgttgaacgctcgaaacgtcatcgcagacaccaagat
gaagaaaaagtgtatcctccaccacaatttattattcctttgaaagatgctaactctcac
gaaggaggcaaagttcactttgaaggtagaattgaacctgtcggagatccgaccatgaga
gttgaatggtacataaatggacgtcctctaacagcaagttctagagctagaacgactttc
caatttggatacatagctttagacttactaagccttatatttgaagataccggagaatat
ttatgccgtgtagtaagctctactggagtcgcagaatccagaggaattttgagagtaacc
gagaggccggcaatcgaattatcctctcaacatcctgacagtcttcaacaaattcaacaa
ctcgaagattattcaaaatatcaaagaacgcaaagcatggaagagataatcgggcaaaaa
ccagtttttattagacctttgaaaaatcttggagaattgcaagaaggtcgcaatgctcat
tttgaagctcaaataacaccagttagcgatcccacgatgaaagttgagtggtacaaagat
ggaagacccattacagcaagttcccgtatctctaccattttcaacttcggatacgtttct
ttgaatataatgcaattgcgccccgaagatgccgggcaatacgttgttaaagccgttaac
cgacttggagaagctgtcagcacttctgatcttcgtgtttttgttcgtcaaagtgttact
ggagattctggtattccagaacaacaacggtacattgataaaaccatggagttagaagca
tatcaacttcaacaacaatataagccggttcctgctggaccaccggaaagcacagaacct
cccgtattcaaatctcctatcaaagatcaaataaatattaaagaaggcgcattcgcccat
tttgaagctagattagaaccattgaatgactcaactttgaaagttgtttggttgaaagat
ggcaaacctgtcgaagccagttcacgaatcacatctttctttaacttcggatatgtcgct
ttaactattaaatacgtcacaagcagagatgtcggcgtatacacttgtaaagcttataat
caattgggtgaagctcaaacgaccgctcaattaaccgtacttggaaaacaagatattata
tttgatagtcaacatccgggaggattgcaaaaaattcaaaacttggaagacagtagtcgc
tatgaaagaatggttaaagaagagcaatccgtaactcaaaaacccagatttttaggacca
ttaaagggtaccaacaaaatagttgaaggtcaaagagctcattttgaagccagagtcgaa
ccccaaaatgacttaactatgaatgtcgaatggtatcacaatggtaaaccattacaaacc
gctaatagaactcaaacttatcacgatttcggctatgtagccttagatattacaagtgtt
aggtcggaagatgcagggtcgtacaccgtagttgccaaaaataaattaggagatgcccaa
gcttctactaccatggaagttgaaacccgatcaagtatcgatacaacaagtatgcatcac
ggtttgtacgaaaaaacaaaacgcttggaagattctaaatttgttgaacctcattatgac
attgaagaaatttcaaaatcaaaaccgattttcactcaaccattatccgatcccaaacct
gttttcgaaggaaagaatattcacttggaatgtagactagaacccatgggtgatcctaca
atgagagttgaatggtactgcaatggtcgccccgtcacagttggatcacgtttccgtacc
tattatgattttggttatgtcgctcttgacataattcaagctcaagctttcgattcggga
gaatacacggtacgcgcaacaaatcatttaggttcagctcatacatcagcttgcgtccga
gtgattggacgatcggatgttgtcaccgaaagtcaaaatgaagccgctctagaacaaatt
caaatgcttgaagattcttcgcgtcataggcgtcacgtgcaagaagatataacaattgtt
caacctcctcaattcacccgacctttgcataacttggaaacaattgaaggaactaatata
catttagaatgccgattgcaaccggttggggatccaaacatgagaattgattggtttgta
aacggcagacctgtaaaaactggacacagatttaaacctgcatatgatttcgattacgtc
gctctcgatcttttgagcgtctaccctgaagattctggtgtttacacttgccaagctaga
aatcaattaggcgaggccgtttcttcttgttctgtcaaaataattgccaagaaagatttg
attttagaatctcaacatccatccggacttgaaaaaattcaatatcttgaagatgcttct
cgatacaaaagatcagaagtaaccgatgaagttgttaaaatgaaacccaaatttacaact
aagccaaaaagcttggaaaatatgcgtgagggaagacacgctcattttgaatgcaaatta
gaacctgttactgattctaatttgaaagtagaatggtataaaaatggtcgtcctattact
gtaggtcatcgattccggcctatacacgacttcggttacgttgccctagacataatcgac
ttgattactgaagactctggaatttacacttgccgggctacgaatatgttgggaatggac
gaaacaacatgttctttgcaatgccttggtagttccgccattcttacaagttctcagaac
gaaataggctacgaaaaaattcaacatttggaagataaatctagataccaaagagcagag
ttcgtcgaagaagttactaaacaatctccaacctttacgacatctctgaaaaatattgac
attaaagaagggcaaagagctcatttcgaatgtcgtctgataccagtttctgatcccacc
atgaaagttgaatggtttcacaataatgttcctttaaaatcgggatcaagatttactgaa
acaaatagctttgggttcgtagcacttgacatactgcattctcaaccggaagattctggt
acttatacttgccgagccataaatgctctaggagaagctcttacttccgctcaattaaat
acaagttcaagaaaatcaatttacttagaaagtcaacacgaaggagctttagacaaatta
agttatctcgaagacgaatccaggcacagaagacatactcaacaggaagaagttgtttct
cagcctcccgtttttacaatgccagttaaagatttgaaagttgccgaaaatcaagcggca
cattttgaagccagattaatacccgtcggtgattcaagattaaaagtcgaatggttaaga
aatggtgtacccattgctgcgtccaacagaattgccaccatgcacgattttggatatgca
gccttgaatatgaagtacgtttatcccgaagattcaggaacttacacttgccgtgcagtt
aacgatttaggagaagctgtaacctccgctacacttgtttgtcaatccaaagcatctttg
ctcttagaaagtcaacacgaggaagctttagaaaaactgcgagccttagaagctggtcgt
cctcagcaaagagaaactgaagaaattattgttactgaagctccacgctttgttgctcaa
ctgaacggacctaataatttgtatgaaggccaaagcgctcactatgaatgtagaatagag
ccgtatccagattccaacatgaaggttgaatggttttgtaatggcaaaccattacaaacg
ggtcacagatatagaactacctatgattttggttttgcatctcttgacgtattaggtgtt
tatcctgaagactcaggtgaatacacttgcaaggccacaaataaattgggaacagcccaa
tcatcaacaactttgaaagtaacaggtcgttcatcaattatctcagaaactcaacacgaa
ggagcaatgcaaaaaatccaatatttggaggatgattcacgctacaagaaaaccgacaga
gaagacgttgtaacaatagaaaaaccacaattcggaagaggtcttaacaatattgatcgc
cttcctgaaggtaaaagcgctcatttggaagccactcttactccgattaatgattcaact
atgaaagttgaatggtttcataatggtaaaccgatcaaacaaggccacagatttaaaact
acatacgactttggttatgtttctcttgacattctctacgcatatcctgaagattctggc
acatacatgtgcaaagccaggaatgcagtaggagaagccgtaacaacttcctctgtcact
gtagattctaaagctggtctggatctaaacacaatggatgctgaaagattgaggaaatta
aaagaactcgaaagttatcaaagaccaaccaaagccgaactggaaccggaaagaagaaaa
cctgtatttacaactgctttgaataatctagaaaatgttaaagaaggagaacacgctcat
ttggaatgcagggttgaacccatagatgatgctaatttaaaaattgaatggtttgttaat
ggtgtaccaataaaaaccggtcaccgcttcagaaccactcatgatttcggatacgtagcc
cttgatattttgtacacttacgccgaagattctggtaactacatgtgcaaggctaccaat
gatttaggagaagctgtgaacacatgttccgtgaaatgtagttctcgtaagagtatttac
ttagaatctcaacatccggacggtcttcaaaaaataaaagaactggaatctcaaagttat
tacactaaaccggaagttgaagaacttcctataactccaccaagatttgtcagcgatctt
cgaggcaccactgaagttatggaaggaggcactgcacactttgaatgtcaagtcgaacct
cttcacgatgcaaacttaagagttgaattttatcataacggaaaacctcttccgtcagcg
tccagatttcacattacttttgactttggttatgtagccttagacattactcactgcgta
ccagaagacgctggagaatacacggctaaagctattaattcattaggagaatgtacatca
agcattaaccttaaagtggttcccaagagcagcatcatttcagagtctcaaagacctgaa
ggtcttgaaaaaattcgtaaacttgaagaacaaactccgtttcaacgaccagaagaacca
gaaccaatcacaaaacaaagaccagtttttactcagcctcttcaaaatattgattctata
aatgaatctggtacagctcattttgagtgcagacttatcccagtaggtgacccaactcta
aaagttgaatggtacagaaatgaaaagttacttgaaaacagttctagaatcaccaaaaca
catgactttggttatgtgtcactcgatatgactcatgtccgccctgaagacgaaggtgtt
tacatgtgccgagcctcaaatcctttgggagaggctgtaactactgcttctatggttgtc
aaaagcaaagctagcatacaacttgacacgcaacacccagaaggaatgaagagaattcaa
aaattggaacagaaggctcctcaacgtgcagaagagcccgaaaaagctttcgataaacct
atatttactcagttattgaccggtccctcagaattatgggagggtcagcacgcacatttt
gaatgtagggttgtaccggtcggagatcccacacttaggcttgagtggtttgtaaacggc
gttgagctaaaaatgggttccagattccgggttaatcacgattttggatttgttactctg
gatataaactccactgtgaccgaagattccggagtttacatgtgcaaggcaatcaacagc
gttggtgaagctgtgacttctacttctcttaaagttaaaccaaaatcggctattgttggt
gacgcacttcatcccgatgcatggcaaaaaatacaattgaaagaagccgaaatgaacaaa
gttcctgctaaatttgttgatacggctccacaacaagctcctgttttcactaaacatctt
caaagtttcgagaaattggttgaagaccaacaagtctttttagaagctcaagttgaacct
cgaacagatcccaacttgagaattgaatggtttaagaatggagaaccgcttgcaaccggt
tcaaggataaaaggaacatttgattttggacttgtaactttaacagtaaataatttaaga
gcagatgattctgctatctacacttgcaaagccaccaatttattaggtgaagccgtttca
acatgtactttgaaaatagaagataaagattggttgatggcacacacacttcatccggat
gctttgccaagattagcagctttagaacaagtgcccaccaaaaaatcagaggctccagaa
cctgtgtttgaaagtcctgctttcattactcatttgaacaatattgaatgccttgagggt
gacaatgttagatttgaatgccaagtcgaaccttcaaaagatccaactcttaaaatcgat
tggttcgtcaatggtaaaacacttccaatgggttccaaatacaaatcttcttacgatttt
ggacaagtggctttagatatatctcattgttacggagaagattccggaatgtacacatgt
agagcaacaaatagcaagggtcaagccactacttcaggaactcttaaatgcgtcggtaaa
caaagtatttaccgagatactcaacatcctatgggtaaggccggtttggaacaagtacaa
aagatcgatgatataactgctggtaaatatcaaaggcaagaatcggcacccgaagcagaa
tttcaaaaaccaattttcgttgtgcctttaccacaagaaaacaaagtcggtgaaggtgaa
ccattacgtttggaatgtcaagtggagcctaaggatgatcctaatttaaaaatcgagtgg
tatttgaacagcaaagctctcgatcacggttctagatttaaaatgacaaacgactttgga
tacgttgctttagacttgatggatgtttacgaaagagatcaaggtatatacacgtgcaag
gcttggaataaagccggagaagcatacacttcgacaacgctttactgcgtcggaaaagat
ggtttaattgaatccacgcaacatcctaaaggaaaggaaggtttagaaaaaattcaggat
ttagaagagtctatgaaaagaccagattctaaaccagttgcacccgaagacgggcaagct
cctcaatttacatctcagttccaacaactatcgaatcttagtgaaggtgatattgctcac
tttgaagcatctctaacccctgtgggtgaccaaacaatggtggtcgaatggttctacaat
ggaaaattgttggaagcaagccaccgtacaagaactgtttacgcctttggaatggtcatg
cttgaaattctcggaacaaaaattgaagattctggcgtttacacgtgtcgtgcaaccaac
aaatggggacaggatgaaataagcgttaatttagaatgtgttgataaatctaaaggccaa
aaaccacgcttcacaacacacattcaaaacatagacaacctcaaagaagggcaagcagct
catttcgaatgcacgcttgtacccgtcggagatccaaatatgaaagtagaatggttccac
aacggagagccattaagacactcttcgagaattaagcatgtgtctgattttggttacgtt
gtaatggacatttcttacgcccaatcacacgacacgggagaatacatttgtaaagcttct
aataaatttggagaagactacacgaaagcaacaattaaatgtaccggaaaaagtggagtt
ttctttgatacattacaacctgattcattggctaaaattagagagcttgaagcttatacc
gcagcctctggaactcaaactccacaagcacctataacagaacctcctaaattcatcact
caaatttctgacattacacaattgaaagaaggtcaaagtgctcactttgaagcacgattg
gttccggttaacgatcctaacatggtggtcgaatggtattgcaacggtaagaaattgcca
cacggtcatcgttatagaactttccacgatttcggaatcgtcattttggacattttgtac
tgttacgaagaaaattcaggagtatacgaatgtagagccactaataaatgcggttccgac
atgaccaaagccagccttaagtgcttctcaaaaaccaatcttattttggattcccaatta
cccaggggaatggaaggaggtttagagaaaattcagaatctagaagattctcatgcgaaa
agtcgcgatgaaaaaacggttgaaacaaaaggaatggctcccgtttttaccgttcctctg
tctaatatcaatgatttaaaagagggtgaaagtgctcactttgaagggagacttattcct
acagatgatcctaaacttaaggttgagtggttttggaatggtaaaccacttaagacgggc
tctagattcagaactttctgcgactttggatttgttatactcgaaatagctccagtttat
cccgaagatgctggcgaatattcttgccgagctacaaatgattacggagaagccgttacg
attgctcaaatgaacgtacaaggaaagagaagcataattttagaatcgcaattgcccaaa
ggaatggagagaacaatcgacaaaatagcagaacttgaaggattaggtcaaatgcaagga
ccttcaacaccagatgaaagtttgggaaaacctccagagtttataaccactcccgaagat
ttgacgttgggtgaaaatagttctgctcatttcgaatgtcgtcttacacctgttaatgat
ccgagcatgagagttgaatggttccacaacggcaaagctctcagtgctggatctcgaatt
cgtacgattaatgatttcggttttgtaatactcgaaattgatggagtttacttcagggat
tctggtttgtacacgtgcaaagcaacgaacaaacacggagaagctaccgtttcttgccaa
ttacaagtgagaggacgtactggcattgatttagaaccacaattaccatctcaatttaaa
acaggaactgaaagtttacaaaaattggaagaatctttgaacaaaaaggaagaaattttg
cccagcgaagaaactccaaatccaccaaaatttattgtcgaattaaaagattgcttaaat
gcccaggaagctaaatctgttcatttcgaatgtagagtcgaaccgactaatgatccaaca
atgagaatcgattggttccacaatggaaaacctttcgccaccggttctagagttcatatg
ttaaacgactttggttttatcgttctcgacatggattacgtctatgccagagacaatggt
gaatacgtttgcagagctactaataaatggggatctgctacaaccaaagctactcttatg
tgcaaggatcaacacaacatcatcttggattctcaattaccccaaggtatgaccggagaa
aaattaaaagatcttgagaagggtcaaggcaccactccacttccagaagatgctcccggt
caacctcctaaatttataacacaaatagaatcggtcagtactactgagggagaacccgta
cactttgaatgcagagtggaacctaaaaacgatcctcaccttaatgtcgaatggtatcac
aatggaaaattacttaaagccggacatcgatttagaactctttttgatttgggatacgta
tctttgactttaataaatgtgtatccggaagatgctggagaatacgtttgcagagcttat
aacaaactcggagaagattttaccaaagcatcacttgcatgcaaaaaaacatcttcaatt
attcttcaaaatcaagttcccaaaggcatgaagaaaagtgaagctctcatgcaaatggaa
gccagtataaagaaatatacttctgaaatatttttgaccgaagatgatttgtacgaacct
gaaaagagacaacctccgagatttgttacacaaatcaaagaaaatctagaactcgttgaa
agagacgtgttcaaatttgaatgtcagttggcacctgttggtgatcctaatatgaaggtc
gaatggtttttcaatggaaaacctttacttcacaaaaatcgtttgcatccgatttacgat
ttcggttacgtcgctctcaatttcgaatgggtttatccagaagatagcggagaatactta
tgccgagcaactaatttgtacggtcaagatgaaacaagagctgttattaaaattgccgga
aagccaagcattatttacgattctcaattgcctaaaggaatgaagagtattgaaaaaatt
cgagaaatggaagccggttggcaacaataccgcgaaacgaaagaagaagaagttaaagaa
aaagaaccgccgcaattcgtcactaaaccagagcctttcgttgtcgtcgaaggagacact
gccagattttgttgtagagttactggttacccaagacctcgcgttatgtggctcatcaat
ggcaaaacaatagtcaatggtacgagaaccaaaattacttacgatggtatgtggcatttg
gacatacctaaaactcgtcaatacgataacggaaaaatcgaagtgatagcaaagaattct
tgcggagaagccgtatgtgacaccactttaaccgttaaaccaagaggagatgattatcga
aacgtattgaaaaactctccgcgtccttggtatgacattgagcttacgggatatcaaaaa
gaacgccaagaaactgaacttgaaaaaatgtttgaagaaagaaatcaaaccgaaagaaat
tttgaaccggaacatttaagaaagaaagaaataaaagaaccggaaacagaatggcagaag
aatgttaaaagcaaaaaaagtgacgattattatggaaaacttcgtgagcttgaagaagaa
caaattataaaagaatcaaaaattagagaaacttctcatcaattcgccatacccggagaa
aaagtttctagaaaatctttagccaaaggaatggctaaaagctacgaagaaagtctagaa
aaagaagaaccggttttggaatggcaacaaaaagccaaagaaagaagtaggcgattaaaa
accgaatacgatgaaactgaaactgaaacggtggaaggcactgataaacgtcggggagtg
agaggagtgcccgagccatcagaatctaccgttcatggaaaagaagttcacgtttccaaa
cagaggcaaaaacaaaaagaaattcaaggagatttagaaataacgagaaatatttcagct
actgaaactactgaagtggaacacaaagcaaccactcatgaaagagtagtcgacggacct
gttaaacctgccaaagctcctttctttactaaaaaaattcaaccttgccgagcttttgaa
caagaacaagcacgattcgaagttgaatatgatggtgatccgatgcctaaagttaaatgg
tttagagaaaaccaacttatcaataactcacccgatttccaaattcatacgtttggaacg
aaatcggtgcttatactgcgacaagtattcttggaagattctggagttttttcagttatt
gctgaaaacaggggtggaactgcaaaatgcagtgctaatcttgtcgtcgaagaaaaaaga
aaaaccggaagaggaggaactattccacccaatttcttaacgaccatacaaagctgcgta
gttcctgctggtcaattagccagatttgacgccaaaatatccggtacgaaaccattagac
gtgtactggttaaaagatggtcaaaaagtattgccagacatacgatttaaagttctcgaa
gaagacaatacgtacaccttattgattattgaagcagcaccagaagattcgggaacttac
gaatgcgtcgccatcaacagttccggagaagctcgatgcgaagctgaatgcgttgtccaa
gctcctgcctcgcgaaaaacaccattaaaaacaccaccatcaccgggtgtcgaaagaaaa
ccaactctaatggaacaattgaaatctcaaatagtaaaagaaggacaatccgtttccttc
cgttgtaaaatatccggcaggccaagtccggaaatccaatggttcaaaggtgaaaattta
atcaaaccatcaaaatactttcaaatgcaaaaggaaggggattggtgcactttaagaata
actgaagctttcccagaagatgaaggaccatacaaatgcgtggctactaatccgggaggc
agcgtttctacaaccgcaaatctcaaagtgacagcaccggattcaaaagaaaaagcaccg
catttaaatccgatgaaagatgtgacagttcaagagggtagtccagcacaatttagaaca
aaagtaacgggagtacctcaaccgacgatacaatggttacgtgagggtatgctaataccc
caaacagccgattttcaaatgatacaagaaggaaacaacgttgttttacttatagcaacg
acatacgaagaagacacaggtatatttacatgtcgagcaacaaattcagcaggacaaagc
gaagtgtctgctcgtctcaccgtcaaaagtaagaattaa

DBGET integrated database retrieval system