KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM541100Help
Entry
Phum_PHUM541100   CDS       T01223                                 

Definition
(RefSeq) titin, putative
  KO
K12567  titin [EC:2.7.11.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM541100
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM541100
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:phu04812]
    Phum_PHUM541100
   04147 Exosome [BR:phu04147]
    Phum_PHUM541100
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Phum_PHUM541100
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Phum_PHUM541100
Membrane trafficking [BR:phu04131]
 Others
  Actin-binding proteins
   Others
    Phum_PHUM541100
Cytoskeleton proteins [BR:phu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Phum_PHUM541100
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM541100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig C2-set_2 V-set Spectrin ApoB100_C DUF3153
Motif
Other DBs
NCBI-GeneID: 8235649
NCBI-ProteinID: XP_002431695
VectorBase: PHUM541100
UniProt: E0W001
AA seq 3224 aa AA seqDB search
MDQYVDVKRASLCVDTILNQLGGRQLDVSDAWRKWLTSINYKKDIFNKWNKNMADSVNTL
EWVTKIQSQLFPILLEDYETCNDVLRELERKESIVIPEIKKSQNDIETRIKEAEELALKG
EVPPPEENQKILKELMEVHEKNQNTLTEYQVLVQMLQSFFKNLAEVEKTIDNTKLNEILN
GAKNKNVQHVENVMKEHEVYCQTVTELFKFTKVECDSIINKINGLEPPHVRQIDVNKIKE
FFNKRQNDFETQSTEKKYELEQERQLCQFDEDLREINSTLSDLNDQLVSIRGQYGESQVT
AKATSQAFVFFEKTIELLEQRIKTFVESGEDLLSSNHSSSPHIERELNKMKDKWKEFYEQ
VKESRRLIDLSIEYYTLIDEAEEWFREGSKLLVVIARKTTLVRKPEEATELLNEVATFLK
PGEVRQDERIRKIGQYANELFGKESSKHILSVVSENREMIESFTLISQELSNLAENLKES
EMERERLKQEQKEMDDNLAACKAEALAAKAAAAAAEEAKRASELAAKALKEITITTQIHK
VEITQVNSVSSKDRYSSPPKKLKTDDGEPPDFVVPLRDATVREGEKFEFKCKVSGQPTPE
IMWLKDGMAVESNPDYQTEFNTEENTCSLKIDETFAEDTATFTCKAINSFGSAETSALLT
VADTVIDENLTPPKFTEPLKPITCKEGGTCELSCRVEGYPLPTVQWYKDQNCVDDVPDYI
ITYNNGEAKLKFEQVFLEDQSEYTCKATNSVGTTETTAYFTVDPLEPTTAPEIIQPLSNV
MARAGQKVKLECEVFGLPEPEISWYHDGKPLRVNHDIITTYKKNMANLCISETFPKDAGV
YKMVAKNIAGEAISTCNVSVKGLLPTETSDSEMASDVEPTKPSIQLQLKDQSVVEKNTVL
MECIIVGQPEPEVIWYHNDEPVKESDDVILIFYGDHCSLLFKDVYLEDAGVYKVVAINSA
GEASSSCYLSVYQEKDENVEKEKNIEVTHENVKIEEVVEVESTKVVETDEKEKSESENVK
IETEDEKLDSEDVKIETVDDEKYEMENVSLEIQDDKLESEGGIVVETDNEKVDGESENQI
MIDEEEKLKKTLPKFTKTLTDVSVEEGEKVSFECCVIGEPKPDIKWYRNNQLIGITQNVQ
MDEDADGNVTLTLTEVTPEDGGTFKVKAINSSGEADSIAQLNVKTVKQYEILTEEKEEED
DSPPVFTKKFNDVTTKENEQVVFTCAVEGKPKPEVKWKINDVEITSNDNYKLSNDGNDYE
LCIFKVGQKETGNVSCVAENEAGKSIYTAKLSVRDSSLHKEVKLIPFIEPKITTNMEIFD
SSKLTTKREIVMESMTSSSSNKIISSSSSSAYGPSSGEPNVEVHSYLSKDETSVTQINQQ
PVEEVKSHESKEYHKKNNDVIVNKEDSSLVTTKTTDNQIEGLVKSNSLLMLGPKLARKSM
VPKFVTPVQGKIVNQGTDVELLGVIEGYPPPTITWTKNGVNVEPVDNKIEISFELNQAKL
KIYNTTPDDAGKYSCQAANSVGTATSTTDLIVKKSVFPPVLGKRLQSQSVPRGERARMEV
EVTGMPEPTVAWFKDDVPIKSCELFRIISQGHCHTLIIDKVNDEHSGRYTVKATNAGGMT
QSIADLVVGEEGQSENYSSITNYHDKIQSAVQLKPEPSDKSSSEVKMESEKTVKNLFDTE
NEIKPEDSVTVTETTKTQKIIRVKLEREGSPGKNEDDKPLEPKIETKIEKIVAVHLPTDK
TSTEETDSSLKGTQSSLEFFKDLLSKNREDSSESKTVESKVESVETTSDLTNVIPSSELF
GKQSKVISEIKTVKSGDNEMEPTIAESIMLPTTLKLANESYSLVREEKSCVKSESIEKKI
HTVFEKPQCDLKLTMPQTTEDENQFVIKPEPPPEVGFIPGSEKSKIFEDVSQKVKKLEEF
NKAGSPAEPPSGGIRLLPLVFPKPVQPEMPQKKETVVEKERVIETLPPLSWLSDESFSKE
DKEVFQSTQSISIKEEKAQNQTMSSYVEPVKSIPPAQLHLPKQRDHRPTSPRPSAEGIAM
EKLWTAKKPYEDYQPLLEPSKPATIYRPSSSLEPMRAASPRPSAEGIAMEKLWTPHRSAD
NSRPASSLGFSNVSPTPKPSQEGIAMDKIWSHSHKETSVNNSWLSAQPKEKIQPTYVKPQ
PVLKTEPSTYLPQTNETTNYQSMESSKNEKYIRQFTEINYPKGPEIKPLPPNVPVTHYIA
KSRLIRQTQSMDRHLEYSSESSSSLQQSWYDSSLTQSNISNYDLKAPSLIQKIQDSEKTS
YQTSQIAPGPPPEFCMSSTESKVYSPKVTEVSSNKSNFYPPPSGFTPVQSTKKIIPPKRE
LKRSISLESKPFERFPDLEPFPFKPDPPRPKPAKCPPPPTPSKFVKCRFTESDYESDYDS
HYSLKWRPYESDNEDLKYRKVKAPSANYQPRRPQSTGPEPLPPSKFENPPQFSGPPRPVI
DTSMKIYSQNVTENKEIKKKLSKVKKTSPPKFKPGSPPKFVQTTPKNKPDSPKAKQKLFK
QPDSGYMADTDEPFGLRKTEESSMVQEDYSKQTLYESYSSKNSMEYSTTRKALESIQNLE
PFPYKVEPIQSAPKNFGPPPPQPSKFFKRELKESDYESDYECRIQPVWNSEGQTYKPVRP
VLTPSGKHHYVNYGRTPTPPTEFDVPPVMEGATRPKFEPIAPETRLHSTSSQMLIKPKPV
TPKILKPGINLKPGSPPEIGFAPAYPKAVETSNIMSFQEDTETSRRIVNVQQTTRMISLE
GKKEKSQFESNYGSNFNKMHYKDSPFKKVKSVESYSKSNNYSSQQTKEPDIILQPGEPPE
LVYAKIPVSVASSYANKHIKDMTHSFKTKAQQFVSDVMTDTKKPDKSILKSSSHSSQQNG
STTNEPHTYREENRFSEKGTKHIDPDTGLIYFKYDFGYEFGIVLPGEGGKKCVSGGGNSS
SSSSKPEIQSAKGLESIDFPVLHEKTCKDVQSSPGKPKKFTHFKSVKWDPMSESEMSEVE
DYQKKRNSFPTKGPQVTIPGNRWESSPSPLSISPMSSISPKCQRSTPLDLSVSPTWNRSN
TPTSTTPGLNQKSVMSQSKEPLSKPNFITPLRDIAVVSGQPARFECIVQAEPTPNVLWMK
DGRILDNSQYHEIQYKNGVCRLTILQAYPADSGNYSCSATNMLGTAETTATLIVPGKKWD
SVEATTQLKFLGVFPFPKGGTFAGIQPEIRSPPPPKPEPPGPHS
NT seq 9675 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtatgtcgatgtgaaaagagcttctctctgtgttgatacaattttaaatcag
ttgggaggacgacaattggacgtgtctgatgcatggcgaaaatggttaacgtctattaat
tataaaaaggatatttttaataaatggaataaaaatatggcggattccgtaaatacttta
gagtgggtaacgaaaattcaatctcaattgtttccgatacttttggaagactacgaaacg
tgcaatgacgttttaagagaattagaaagaaaagaatctatcgttataccggaaataaaa
aaatcacaaaatgatatcgaaacgagaataaaagaagctgaagaattagcattgaagggc
gaagtcccaccgccggaggaaaatcaaaaaatattaaaagaattgatggaagtccatgaa
aaaaatcaaaatactttgacggaatatcaagttttggtgcaaatgcttcaatcatttttt
aaaaatttggccgaggtcgaaaaaactatcgataacacaaaattaaatgaaattttgaac
ggtgcgaagaacaaaaacgttcaacatgttgaaaacgtcatgaaagaacacgaagtctac
tgtcaaaccgtaaccgaattatttaaatttaccaaagtcgaatgcgatagcataattaat
aaaataaacggattagaaccccctcacgtgagacaaatagacgtgaacaaaataaaagaa
tttttcaacaagagacaaaatgatttcgaaactcaaagcacggaaaaaaaatacgaatta
gaacaggagagacaattgtgtcagttcgacgaagaccttagagaaatcaattcgacgttg
agcgatttgaacgatcaattggtatcgataagaggtcaatatggagaatctcaggtgacg
gccaaagcaacatcacaagcatttgtattttttgaaaaaacaatcgagcttttagaacaa
aggataaaaacttttgttgaaagcggagaagatttactcagttcgaatcattcttcttct
ccgcacatagaaagagaattgaataagatgaaagataagtggaaagaattttacgagcaa
gtcaaagagagtcgaagattgattgatttgagcatcgaatattatactcttatcgacgaa
gccgaagaatggttcagagaaggtagcaagttgttggttgtgattgcaaggaaaacaaca
ctggttagaaaaccggaagaagccacggaattgttaaatgaagttgctacttttttgaaa
cccggtgaagttagacaagatgaaagaattagaaaaattggacaatatgcaaatgaatta
ttcggaaaagaaagttccaagcatatactttcggtggtgagcgaaaatcgcgaaatgatt
gaatcgttcacgctcatcagtcaagaactgagtaatcttgccgaaaatttgaaagaatcg
gaaatggaaagagaaagactgaaacaagaacaaaaagaaatggatgataatcttgctgct
tgtaaagcggaagctcttgcagctaaagctgctgcggcagctgcagaagaagctaagcgt
gcttctgaactagccgcgaaagctttgaaagaaataacaatcacaactcaaattcataaa
gttgaaatcactcaagtcaattcggtgtctagcaaagatagatattcatctcctccgaaa
aaattaaaaacagacgacggagaaccaccggactttgtcgtacctttacgcgatgccacc
gtgcgggagggtgaaaaatttgaatttaaatgcaaagtgtccggtcagccaactcctgaa
ataatgtggctcaaagatggtatggctgtcgaaagtaatcccgattaccaaactgaattt
aacaccgaagaaaacacgtgtagtttaaaaattgatgaaacgtttgcggaagacactgcg
acattcacgtgtaaagccatcaattcttttggatcggctgaaacaagcgctttattgaca
gttgcagacacagttattgatgaaaatcttactcctcctaaatttaccgaacctcttaaa
cccatcacctgtaaagaaggaggaacgtgcgaattatcttgtcgcgtagaaggttatcca
cttccaacagttcaatggtataaagatcaaaattgtgtggatgacgttcccgactatata
ataacttacaataacggtgaagcaaagttaaaatttgaacaagttttcctagaagatcaa
tcggaatacacatgcaaagcaactaacagtgttggcacaacagaaactacagcgtatttc
actgtcgatcctcttgaacctacaaccgcacctgaaataattcaaccgttgtctaacgtg
atggcgagagccggtcaaaaagtaaaattagaatgtgaagtttttggattgccggaaccg
gaaatttcatggtatcacgatggaaaacctctcagagttaatcatgacataatcacgacc
tataaaaagaacatggctaatttatgcatttctgaaacttttccaaaagatgctggagtg
tataaaatggttgctaaaaatatagccggagaagctatcagcacgtgtaatgtttccgta
aaaggtctcttaccgaccgaaacatcagattcagaaatggcgagcgatgtagaacctacg
aaaccttcgatacaattacaattaaaagatcaatcggtcgtagaaaaaaatacagtgctg
atggaatgtataatcgtcggccaacccgaacctgaagttatttggtatcataatgacgaa
ccagttaaagaatcagatgacgttatattgattttttacggagatcattgttccctctta
ttcaaagatgtttatttggaagatgctggagtttataaagttgttgccataaattcagct
ggtgaagcgagcagttcttgctacctttctgtttatcaggaaaaagatgaaaacgtcgaa
aaagaaaaaaatatcgaagtgactcatgaaaatgtaaaaatagaagaagttgttgaagtt
gaaagcacgaaagttgttgagactgatgaaaaggaaaaatccgaatctgaaaatgtgaaa
atcgaaacggaagatgaaaaattagacagcgaagacgttaaaatagaaacggtcgacgat
gaaaaatatgaaatggaaaatgttagtttagaaattcaagatgacaaattggaaagcgaa
ggaggtatagtggtcgaaactgacaatgaaaaagttgatggtgaaagtgaaaatcaaata
atgatagacgaagaagaaaaattaaaaaaaactttacccaaatttacaaaaacattaacc
gacgtgagtgtcgaagaaggagaaaaagttagttttgaatgttgtgtcataggcgaaccc
aaaccggatatcaaatggtatagaaacaatcagttaataggaattacgcaaaatgttcag
atggatgaagatgccgatggcaatgttactctaacccttaccgaagtgacacccgaagat
gggggtacattcaaagtaaaagcaatcaattcatccggtgaagcagattcaattgctcaa
ctaaacgtcaaaacggttaaacaatatgaaatattaaccgaagaaaaagaagaagaagat
gattctccgcccgtgtttaccaaaaaatttaatgacgtcacaactaaagaaaacgaacaa
gttgtatttacgtgcgccgtggaagggaaaccaaaacctgaagtaaaatggaaaataaac
gacgtagaaatcacatccaacgataattataaattatcgaatgatggaaacgattacgaa
ttatgcatatttaaagttgggcaaaaagaaactggaaacgtttcttgcgtggccgaaaat
gaagctggaaaatcaatttacacggctaaattatccgtaagggattcatctcttcataaa
gaagttaaattaattccgtttatcgaaccgaaaataaccacaaacatggaaatattcgat
tcgtcaaaattgacaacgaaacgagagatcgttatggaatcgatgacgtcatcgtcgagt
aacaaaataatttcctcgtcgtcgtcgtcggcgtacgggccttcttccggagagccgaac
gttgaagttcacagttacctgtcaaaagatgaaacttctgttactcaaatcaaccaacag
cctgttgaagaagtaaaaagtcatgaatctaaagaatatcataagaaaaataatgatgtt
attgtcaacaaggaagattcatcgttagtaacaacaaaaactacggataatcaaattgaa
ggattagttaaatctaattctttgctcatgttgggccctaaattggctcgaaaaagtatg
gtacctaaatttgtgacacctgtacagggtaaaatagttaatcaaggaacggatgttgaa
ttgttgggagttatcgaaggatatccgcctcctacgattacttggactaaaaacggagta
aacgtcgaaccggttgataataaaattgaaataagtttcgaattaaatcaagcgaaattg
aaaatatataacacgactcctgatgatgcgggaaaatattcatgccaagctgctaatagc
gtcggtacggctaccagcacgacagatttaatcgtcaaaaaatcggtgtttccaccggtt
ttgggaaaaagacttcaatctcaatcggttcccagaggagaaagagcgagaatggaagtt
gaagttacgggaatgcccgaacccactgttgcatggtttaaagatgatgttcctattaaa
tcatgtgaattatttagaataatcagtcagggtcattgtcacactttaatcatcgacaaa
gtaaatgatgaacattcgggaaggtatactgtaaaagctactaacgcgggtggtatgact
caaagtatagcagatttggtggtaggggaggaagggcaaagtgaaaattacagttcaatc
actaattatcacgataaaattcaatcggctgtgcaattgaagccggaaccttcggataaa
tcatcatcggaagttaaaatggaatctgaaaaaacagtaaagaatttatttgatactgaa
aatgagataaaacccgaagattccgttactgtcaccgaaacaactaaaactcaaaaaata
atacgtgtaaaacttgaaagagagggttctcctggtaaaaacgaagatgataaaccgcta
gaacctaaaattgaaacgaaaatagaaaaaatagtagcagttcatcttccgacggacaaa
acttcgacggaagaaactgatagttcattaaaaggaacacaaagttctttagaatttttt
aaagatttattgagtaaaaaccgtgaagattcatcagaaagtaaaaccgtcgagtctaaa
gtggagtcggttgaaacgacctcggatttgacgaacgttattccctcatccgaacttttt
ggaaaacaatcaaaagtaatttcggaaataaaaacagtcaaaagtggagataatgaaatg
gaaccgacaattgctgaaagtataatgctacccacaacattaaaattagccaacgaatca
tactcattagttagagaagaaaaatcttgcgttaaatcggaatctattgaaaaaaaaatt
cacaccgtatttgaaaaacctcaatgcgatttaaagctaacaatgcctcaaaccacagaa
gatgaaaatcaatttgtaattaaaccggaacctccaccagaagtgggttttattcctggt
tcggaaaaaagtaaaatttttgaagatgtttctcaaaaagttaaaaaattggaagaattc
aataaagctggttctccagcagaacctccttctggcggaatcagattgttaccattggtt
tttccaaaacctgttcaaccggaaatgccacaaaaaaaagaaacggttgttgaaaaagaa
agagtaatagaaacgcttccgccactttcatggttatcagacgaatctttttctaaagaa
gataaagaagtatttcaatcgactcaatctatctctattaaagaagaaaaagcccaaaat
caaacaatgtcgtcctatgttgagcctgttaaaagtataccgccggcacagttacactta
cccaaacaaagagatcacagacccacatctcctcgtccctctgcggaaggtatagctatg
gaaaaattgtggactgccaaaaaaccgtatgaagattatcaaccgttattagagccttct
aagcctgctaccatttatagaccgtcgtctagtttggagccgatgagagcagcttcgcca
agaccttcagcagaaggtattgcaatggaaaaattatggactccacacagatctgctgat
aattcacgaccagcgagttctttaggattttccaatgtttctccgacaccaaagccatct
caggaaggaatagcgatggataaaatctggagtcatagccataaagaaacaagtgtcaat
aatagttggctttcagctcagccaaaagaaaaaatacaaccgacttatgtgaaacctcaa
cctgttttaaagactgaaccttctacatatttacctcaaacaaatgagactacgaattac
cagtcaatggaaagttcaaaaaacgaaaaatacatcaggcaatttacagaaatcaattat
ccaaaaggacccgaaataaaaccattgcctccaaacgttcctgtcactcattacattgca
aaatcacgcttaattaggcaaactcaatcaatggatagacacttggaatattcttctgaa
agtagttcatcgttacagcaaagttggtacgacagcagtcttactcaatcaaatatatcg
aattacgatcttaaagcacctagcctaattcaaaagatacaggattctgagaaaacatcg
taccaaacttcacaaatcgctccagggcctccccctgagttttgtatgtcttcgactgaa
tcaaaggtgtactctcctaaagtgacagaagtttcaagtaacaaaagtaatttttaccca
ccaccttcaggatttactcccgtgcaatcaacaaagaaaataatacctccaaaaagggaa
ttgaaaagatcgatttctttggaatcaaaacctttcgaaagatttcctgatctagagcct
tttccatttaaaccagatccaccgaggcccaaaccagccaaatgtccaccccctccgaca
ccatcaaaatttgttaaatgtcggtttacggaaagcgattacgaaagcgattacgattct
cactattcgttaaaatggaggccgtacgaaagcgataacgaagatcttaaatacagaaaa
gtaaaagcaccgtctgcaaattatcaacctagaagacctcaatccaccggtcccgagcct
ttgccaccttcgaaatttgaaaatccacctcaattctcaggccctcctcgtccagttata
gatacgtcaatgaaaatatattcacaaaatgttacggaaaacaaagagattaaaaagaaa
ttgtcgaaagttaaaaaaacatcccctcctaaattcaaaccgggatctcctcctaaattc
gttcaaacaactcctaaaaataagcccgattcaccaaaagcaaagcaaaaattatttaaa
caaccggatagtggctacatggcggatacagatgaaccattcggtttaagaaaaacagaa
gaatcttcgatggtacaagaagattattcaaaacagacactttatgaaagttactcttcg
aaaaattcaatggaatactcgacgacaagaaaagctcttgaatcgattcaaaatttggaa
ccttttccatataaagtggaacccattcaatcagcaccgaaaaactttggaccacctcct
cctcaaccatcgaaattttttaaaagagaattaaaagaaagcgattatgaaagtgattac
gaatgtcgaattcaacctgtttggaattcggaaggtcagacgtataaaccagtaagaccg
gttttaacacctagtggaaaacaccattacgttaattatggccgaactccgacgccgccg
acggaattcgatgttcctcctgttatggaaggtgcgacgagacctaaatttgagcctatc
gcacccgaaaccaggttacattctacatctagtcaaatgttgatcaaaccgaaaccagtc
acgccgaaaatcttaaaaccaggtattaatttaaaacctggatctccgccagaaattgga
ttcgcacctgcttaccccaaagcagttgaaacatcaaatataatgagttttcaagaagat
acggaaactagtcgcagaattgtcaacgttcaacaaacaactagaatgatatctttggag
ggaaaaaaggaaaaatcgcaatttgaaagcaattacggaagtaattttaataaaatgcac
tacaaagattccccgtttaaaaaagttaaatcggtggaatcttattcaaaatctaataat
tattcttctcaacaaacaaaggagcctgatataatacttcagccgggagaaccaccagag
ttggtctacgctaaaataccagtatccgttgcgtcatcatatgctaataaacatatcaaa
gatatgacgcattctttcaaaaccaaagctcagcaatttgtcagcgacgtaatgacggat
accaaaaaaccagataaatcaatattaaaatcatcatctcattcgtcgcaacaaaacgga
agtacaacgaatgaaccgcatacgtacagggaagaaaacaggttttctgaaaaaggaaca
aaacatatagatccagatactggacttatttacttcaaatacgatttcggatatgaattt
ggcattgtgttgccaggagaaggaggaaaaaaatgcgtgtctggtggtgggaatagtagt
agtagtagtagtaaaccggaaatacaatccgcaaaaggactggaaagtattgactttcca
gttttacacgagaaaacgtgtaaagatgttcaatcgtctccgggaaaaccaaaaaaattt
actcatttcaaatcggtcaagtgggatccgatgtcggaaagcgaaatgtctgaagtcgaa
gattatcagaaaaaaaggaacagctttccaacaaagggtcctcaagtgaccatacctgga
aatagatgggaatcatccccgagtcctttatcaatatctccaatgtcgagtatatctccc
aagtgtcaaagatcgacaccccttgacctatcagtgtcacctacctggaacagaagtaat
actccgacgtccactactccgggactcaatcaaaaaagtgttatgagtcaatcgaaggaa
cctttgtcgaaaccgaatttcataaccccgttaagagatatagctgtggtcagtggacaa
ccggcaagattcgaatgcatcgtacaagctgagccaacgccaaacgtattgtggatgaaa
gatggtagaattttagacaacagtcaatatcacgaaatacaatataaaaatggagtttgc
agattgaccattttgcaagcatatcctgccgacagtggaaattattcttgttcggcaaca
aacatgttaggcacggcagaaacgacggcaactcttattgtcccagggaaaaaatgggac
tcagtcgaagccaccacccaattaaaattcctgggtgtgtttcctttcccgaagggaggg
acgttcgcgggaatacaacctgaaattcggtctccaccccctcctaagccagaaccacca
ggtccacactcgtga

DBGET integrated database retrieval system