KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM551530Help
Entry
Phum_PHUM551530   CDS       T01223                                 

Definition
(RefSeq) SAX, putative
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Phum_PHUM551530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phu01001]
    Phum_PHUM551530
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     Phum_PHUM551530
Protein kinases [BR:phu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   Phum_PHUM551530
Cytokine receptors [BR:phu04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   Phum_PHUM551530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 8234632
NCBI-ProteinID: XP_002431851
VectorBase: PHUM551530
UniProt: E0W0F7
AA seq 589 aa AA seqDB search
MASNWYILCLLFIFTSESGSVTLPPGSLVESDSDTEIKEQVEDNTIANELLIKAQQEQTL
RLHKNLIRHLNRNESHEVPKFKCLSCDPPDCIPQPPCIDAYQCWKSHTRDLNGVEAVSRG
CIKKKDQVPLLCKTSSFSGVHKKRHTGGQYEVICCEEDYCNNGSFPSLPEVTFHDDVSSI
YPDKNIYILKLTLAILGPVVGLGVLGTIVLLLMRRTHKKRLERQSGLWSKERQNGILDSD
AYYTDELVHVTAPGDSTLREFMEHSLTSGSGSGLPLLIQRTLAKQISLSECIGKGRYGQV
WRGVWHGENIAVKIFFSRDEASWNRETEIYSTVLLRHENILGYIGSDMTSRNSCTQLWLV
THYHPLGSLYDHLNRTSLTHHQMMKICLTIVSGLVHLHSEIFGTQGKPAIAHRDLKTKNI
LIRMNGSCVIADFGLAVTHVQATGQMDIADNPRVGTKRYMAPEVLEETMKTDCFESYRRA
DMYALGLVLWEVCTKTLSNGIADEYKPPYHDVVPNDPSFEDMRKVVCVDGQRPILSNRWS
SDPTLNGMGKLMKECWHQNPNVRLPALRIKKTLIKLASADPLIHLDVDI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctaattggtatatattatgtttattgtttatttttacttctgaatccggttca
gttacattacctcctggatctttagtagaaagtgatagcgatacagaaataaaagaacaa
gtggaagataatactattgcaaatgaattattaataaaagcccaacaagaacaaacgttg
aggttacacaaaaatttaataagacatcttaatcgtaatgaatcacatgaggtacctaaa
tttaaatgtctttcttgtgatcctccagactgcattccacagcccccatgtattgatgcc
tatcagtgttggaaatctcatacgagagatttgaatggcgttgaagccgtgtctagagga
tgcattaaaaaaaaagatcaagtgcctttactttgtaaaacttcatctttttccggagtt
cataaaaaacgacatacaggcggacaatatgaagtgatttgttgcgaagaagattattgt
aacaatggttcatttccttctctgccagaagttacttttcacgatgatgtgtcttcgatt
tacccagataaaaatatatatattcttaaattgacgttggcaatcttgggtccagttgta
ggtttaggagtattgggtacgatagttttactcctaatgagaagaacacataaaaaaaga
cttgaaagacaaagcggtttgtggagtaaagaaaggcaaaatggtattttagattcggat
gcttactacacggatgagttggtccatgttacagctccaggagatagtacacttcgagag
tttatggaacattctctaacttctggatccggatcaggacttccattattgattcagaga
actttggcaaaacaaatatccctttccgaatgtattggaaaaggaagatatggacaggta
tggagaggcgtttggcacggtgaaaatattgcggtaaaaatatttttttcaagagacgaa
gccagttggaacagagaaacggaaatttatagtaccgttctccttcgtcatgaaaatatt
ttgggttacattggaagcgacatgacgtcgcgaaattcatgcactcaactttggttggtc
acacattatcatcccctgggatccctttacgatcacctgaacagaactagtttaacacat
catcaaatgatgaaaatttgtttgacgattgtttcgggtttagttcacttgcacagtgaa
atcttcggaactcagggaaaacctgccatagctcacagagaccttaaaacgaaaaatata
cttatacgaatgaacggttcttgcgtcattgccgatttcggattggccgtgactcacgtt
caagcaacgggacaaatggacatagcagataatcccagggtgggaacaaaacgttacatg
gcacctgaagtattagaagaaacaatgaaaacagactgtttcgaatcgtacaggcgagct
gatatgtatgccttgggccttgttttatgggaagtgtgtacgaaaaccctttcgaacggc
attgccgacgagtacaagccaccctatcacgacgttgtgcctaacgatccctcattcgaa
gacatgagaaaagtcgtttgcgttgacggacaaagacccattctcagcaacagatggtct
tcggatcccacattaaacggcatgggaaaattaatgaaagaatgttggcatcaaaatccc
aacgtgagactgccagcgttaagaataaaaaagactttgatcaaattggcatcagccgat
cctttgatacacctcgacgtagatatttaa

DBGET integrated database retrieval system