KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM564490Help
Entry
Phum_PHUM564490   CDS       T01223                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase 30 kDa subunit, putative
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00190  Oxidative phosphorylation
phu01100  Metabolic pathways
Module
phu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Phum_PHUM564490
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Phum_PHUM564490
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Phum_PHUM564490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 8234782
NCBI-ProteinID: XP_002432001
VectorBase: PHUM564490
UniProt: E0W0V7
AA seq 222 aa AA seqDB search
MASMIRGVLRNIKPFTQNKKIFSDVRKYCQKVTENGKTTHFGKYVSECLPKYVQMIQMTS
QGELEILIAPEGVLPVMQFLKDHHNCQFESLVDIAGMDVPGREYRFEIIYNLLSLRYNSR
VRVKTYTDELTPIDSVYEVYRAADWYEREVWDMYGVYFKNHPDLRRILTDYGFEGHPQRR
DFPLSGYVEVRYDDEVQRVVCESLDKTPAFEILFRFNTMRIS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctatgattcgaggtgttttaagaaatattaaaccttttacgcaaaataaaaaa
atattttccgatgtacgaaaatattgtcagaaggttaccgaaaatggtaaaacaacacat
tttggaaaatatgtaagtgaatgtttacccaaatatgttcaaatgattcaaatgacatct
caaggagaattagagattttgatagctccagagggagttttacctgtgatgcaatttctt
aaagatcaccataactgtcaatttgaaagtttggtcgatattgctggaatggatgtacct
gggagggaatacagatttgaaattatctataatttattgtcattgcgttataactctaga
gtaagggttaaaacatatacagatgaattaactcccatcgactctgtttacgaagtgtac
agggcagcagattggtacgaacgagaggtatgggatatgtatggagtatattttaaaaat
catccagacttgagaagaatcctaacagattatggttttgagggtcatccacagagaagg
gatttcccattaagtggttatgtagaagttcgttatgatgatgaagttcaaagagttgtt
tgtgagagtctcgataagacgcctgctttcgaaattttatttaggtttaacacgatgaga
atttcttag

DBGET integrated database retrieval system