KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM564720
Entry
Phum_PHUM564720   CDS       T01223                                 

Definition
(RefSeq) NEDD8-activating enzyme E1 regulatory subunit, putative
  KO
K04532  amyloid beta precursor protein binding protein 1
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
KEGG Orthology (KO) [BR:phu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phu04121]
    Phum_PHUM564720
Ubiquitin system [BR:phu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   Phum_PHUM564720
SSDB
Motif
Pfam: ThiF
Other DBs
NCBI-GeneID: 8234795
NCBI-ProteinID: XP_002432014
VectorBase: PHUM564720
UniProt: E0W0X0
AA seq 539 aa
MASPAPKSPEQSDKNRKYDRQLRLWGDHGQSALENAKVCLINANCLGTEILKSLVLPGIG
SFTIVDGKKVTDDDIESNFFLLADSCGKSRAEVTNQLLVELNPDVHGDYIDEDIEQVLEN
NPEFLNNFSIIVATELKEKTLMELSSKLWELDIPFLNCKSYGFLGYIRTQVKEHTVIESH
PDNLPQDLRLDKPFPALIEYVNSVNLEEMELKDHAHVPYLVILFKYLEIWKKSTGKDFPR
NFKEKESLKEMIRSGILKNDEGVPEVEENFEEAIRGINSAVIPTIVPSSIKQILDDDACI
NLTSKSKPFWVLAKALRDFIENEGNGCLPLRGSLPDMTANTFSYIALQQIYHTQAAKDAD
IVFRRVQQLLRELNQSPDTISEADTKLFCKHASELQLVRGTCITDEYQGKNTSLQSIVSE
LEPPGSMLLYYLLLRGVEKFYGEYNRYPGECNDDVQPDIVQLKGCIAKLLGEWGSGPLSK
DDYVHEICRYGGCELHSISSFVGGCAAHEIIKLITKQYLPIQNTFIYDGMSSITATFSL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcgtcaccggcacccaaatcacccgagcaatctgacaaaaacagaaaatatgacaga
cagttgaggttatggggtgaccatggccaaagtgctttggaaaatgcaaaagtttgtctt
ataaatgctaattgtttgggtacggaaattttaaaatctttagttttaccaggaataggt
tcatttacaatagtagatgggaaaaaagtcaccgacgatgatattgagtctaattttttc
ctgttggccgacagttgcgggaaatctcgggccgaagtaacaaatcagcttttggttgaa
ctaaatccagatgttcatggtgattatattgatgaagacatagaacaagtattagaaaat
aatccagaatttttaaataatttttctattattgttgctactgagttaaaagaaaaaaca
ttaatggaattgtctagtaaattatgggaactagatatcccatttttaaattgtaaaagt
tatggatttttaggttatattcgaactcaagttaaagaacatactgtgatagaatcacat
cctgataatttgcctcaggatttaagactcgataagccattccctgcattaatagaatat
gtcaactctgttaatcttgaagaaatggagttaaaagatcatgctcatgtaccatatcta
gttattttatttaaatatttagagatttggaaaaaatcaactggaaaagattttccaaga
aattttaaagaaaaggaatctcttaaagaaatgattagatctggaattcttaaaaatgat
gaaggtgttcctgaagtagaagaaaattttgaagaagctattagaggtatcaattcagct
gtgatacctacaattgttccttctagtattaaacaaattttagacgatgatgcttgcatc
aatttgacctctaagagtaaaccattttgggttttggcgaaagcattaagggattttatt
gaaaatgaaggtaatggctgtttaccattaagaggatccttacctgatatgacagccaac
acatttagttatattgctctacagcaaatttatcatacgcaagctgctaaggatgccgat
atagtttttagaagagtacaacaattattacgagaattgaatcaatcacctgatacaata
tcggaagctgatacgaaattattttgcaagcatgcttcagaattacaattagtgaggggt
acttgcattacagatgaatatcaagggaaaaatactagtttacaaagcatagtttcagag
ttggaacctcctggaagcatgcttctctattatcttttattaagaggagttgaaaaattt
tatggagaatataatagatatcccggtgaatgtaatgatgatgtgcaaccggatatcgta
caacttaaaggatgtatagcgaaattattaggtgaatggggatctggtccattgtctaaa
gatgattacgttcatgagatttgtagatacggtggttgtgaacttcattcaatttcatca
tttgtcggtggttgtgcagctcacgaaataataaaattaattacaaaacagtatttaccg
atacaaaatacattcatatacgatggaatgagttcaattacggcaacttttagtttgtaa

DBGET integrated database retrieval system