KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM574200Help
Entry
Phum_PHUM574200   CDS       T01223                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase, putative
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Phum_PHUM574200
Protein kinases [BR:phu01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   Phum_PHUM574200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH YrbL-PhoP_reg Kinase-like ABC1
Motif
Other DBs
NCBI-GeneID: 8234946
NCBI-ProteinID: XP_002432164
VectorBase: PHUM574200
UniProt: E0W1C0
AA seq 556 aa AA seqDB search
MPLSQSQNRPALNNIESSSAIQSEIYLSRVPVETNESDNHNGHLNINHFPAINNDDEQLP
SVLPTLTSSALVNIPISSSEVDKNQTPNKTCSSKQNSVFATPEKVVGLYYAKLTPYERKE
IFNYSHIYFIGANSKKRPGIIGSPNNCGYDNEQGSYMHVLHDHIAYRFEVLKVIGKGSFG
QVVKAYDHKNQENVALKMVRNEKRFHRQAQEEIRILEHLRKQDKDNTMNIIHMLDHFNFR
NHTCITFELLSINLYELIKKNKFQGFSLQLVRKFSHSLLQCLDALYKNNIIHCDMKPENV
LLKQPGRSGIKVIDFGSSCYENKRVYTYIQSRFYRAPEVILGARYSMAIDMWSLGCILAE
LLTGFPLLPGEDEADQLACIMELLGMPPQKLLEQSKRAKNFINSKGYPRYCTASVLPDGS
TVLSSGLSRLGKSRGPPGSKELRRALKGCDDHLFLDFIQRCLAWDPEERMSPNTALRHAW
LRRRLPKPPGNVTTGESKQEVNSAIIRTPAKASTISKLNKLRVQVSEDRTNSLAMISRNS
HGRMSKLPQIPATNPI
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccactatcgcaatctcaaaatcgtcccgcattaaataatattgaatcttcgtcagct
attcaaagtgaaatatatttatctcgcgtcccagtagaaacaaacgaatcagacaatcac
aatggtcacctaaatattaatcattttccagccattaataacgatgatgaacagttacca
tcagttttgcctactctcacatcttcagccttagtaaatatacctattagtagtagtgaa
gtggataaaaatcaaacaccaaataaaacatgttcttctaagcaaaattcagtttttgca
acacctgaaaaagttgtcggattatattatgcaaaattaactccttatgaaagaaaagaa
atattcaattattctcatatatatttcattggtgccaattcaaaaaagagacctggtatt
attgggtcaccaaataattgtggttatgataacgaacaaggatcctatatgcatgtttta
catgatcatattgcttatagatttgaggttcttaaggtaattggaaaaggtagctttgga
caagttgtaaaagcatatgatcacaaaaatcaagaaaatgtagctttaaaaatggttagg
aatgaaaaaaggtttcacaggcaagctcaagaggaaattcgaatattagaacatttacga
aagcaggataaagataacacaatgaatataattcatatgttggaccattttaactttcgt
aaccacacatgcattacatttgaacttctttcaattaatttatatgaattaattaaaaaa
aataaatttcagggctttagcttacaattagtaagaaaattttctcattcgcttttacag
tgtttagatgcactttataaaaataatattatacattgtgatatgaaaccggaaaatgtc
cttttaaaacaaccgggacgatctggaattaaggttattgattttggttcgagttgctac
gaaaacaaaagggtatatacatacattcaatctaggttttatagagctccagaagtaata
ctcggtgccagatacagcatggctattgacatgtggagcctaggttgtattttagcagaa
ttattaacagggttccccctccttccaggagaagacgaggctgatcagttagcttgcatt
atggaattattgggaatgcccccgcaaaaacttttagagcaatctaaaagagctaaaaat
ttcataaactctaaaggttacccccgatattgtacggcatcggtgcttcccgacggatcc
acagttttaagtagcggtttgtctagattgggaaaaagcaggggtccacctggttcgaaa
gagttgagacgagctttaaaagggtgcgacgaccatttattcttagactttattcaacgt
tgtttagcttgggatccggaggagcgaatgagtccgaacacggcattgagacacgcttgg
ctgagaagaagattaccaaagcctccgggaaacgtgacaacgggagaatccaaacaagaa
gtaaattcggcgataattagaactcctgcaaaagctagcacaataagcaaattaaataaa
ttgagagttcaagtttccgaggataggactaattcattagcaatgatttctaggaattcc
cacgggagaatgtcgaaacttccacaaataccggcaacaaatcctatttag

DBGET integrated database retrieval system