KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM578820
Entry
Phum_PHUM578820   CDS       T01223                                 
Name
(RefSeq) multidrug resistance protein, putative
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Phum_PHUM578820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phu02000]
    Phum_PHUM578820
   04147 Exosome [BR:phu04147]
    Phum_PHUM578820
   04090 CD molecules [BR:phu04090]
    Phum_PHUM578820
Enzymes [BR:phu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     Phum_PHUM578820
Transporters [BR:phu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    Phum_PHUM578820
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM578820
CD molecules [BR:phu04090]
 Proteins
  Phum_PHUM578820
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 RsgA_GTPase G-alpha Zeta_toxin AAA_22 AAA_15 AAA_29 AAA AAA_30 AAA_5 AAA_21 AAA_14 AAA_25 DUF815 AAA_7 Rad17 AAA_24 MMR_HSR1 AAA_18 PduV-EutP Mg_chelatase DUF4131
Other DBs
NCBI-GeneID: 8232191
NCBI-ProteinID: XP_002432260
VectorBase: PHUM578820
UniProt: E0W1L6
AA seq 1273 aa
MKKKENGISTLSYVNESFMQDGDEKFDKETKNDIINPQKPFDPPIISFHKLFRFADPFEI
CLMLLGVVGSIITGLSAPGNTLIFGELTDALVNFSLGTIGTEEFLGKVHHSKKDLCILDS
VDGFVINNSIIGLILLTITFISISLFGYATQRQIYRIRTKYFRSALSQDIGWYDINNTGD
FASRMSEDLNKLEEGISEKCLHVVHSLSAFVGCIVLALLKGWELALISLSSLPVISITIG
VIGFISSRLSKNELEAYAKAGSIAEEVLSSIRTVVAFDGSNKESLRYEKYLLEAKQNNVK
RKFFNGISFGALWFLIYATYGFAFWFGVSFVFDGKYSPGQMTTVFFSVMVGSMNFGITTP
YIEVFASAKAAGAKVFWVIDRISSINPNSNEGLKPDKMKGNIEFKDVKFSFPSRPNVPVL
NGISLKINNGETVALVGSSGCGKSTCLQLIQRFYDPSSGSVLVDEEEVKNLNVKYLRQHI
GVVGQEPVLFATSIKENIRYSNENATMDDIIASAKMANAHNFISKLPQGYDTIVGDRGAQ
MSGGQKQRIAIARALVRNPCILLLDEATSALDNASEAKVQAALEKAAKGRTTIIVAHRLS
TIRQADKIIVMSKGTIVEEGTHDSLIEKKGHYFDLVTAQRQAFNENDKNEKEEIEEDSKD
IYDAFDRKDSTVPSKTDVRVLVTETDKPKEKITLFEIIKLNAPEWKIITIATLSSMAIGF
CSPFFSIVFGNIMGVFSIPDKDQALSETVSYCLYFVGIGVLMGLGTFIQIWAYGTAGEIL
TMRLRYMTFSAMLKQEMSWFDDKSNSVGALCSRLSGDTSNVQGATGQPIGSVVQGIATIS
LALSFAMYFQWKLGFTTLAFAPFLFAGSYFMARVLKGDAKGNQKILEKSTAIAIEAVGNI
RTVASLGRENSFYKEYENELLPSNKIMTRNSQIKGLIMGVSRSLMFFAYAACMFYGGRLI
AYESVHYQDVFKVTQTMIMASFSLANAFAFAPNFQKGLTSATNLFLFLRREPKIKSPDVT
RVDSEWEAQGEVKYDNVSFRYPSRPDAQILKNLNLQVLKGKKVALVGQSGCGKSTLIQLL
ERLYDPDEGEVFLDSEEIKTLKLSALRKQLGIVSQEPVLFDRTISENIAYGDNDRKVEMD
EIIEAAKQANIHDFISNLPLGYDTSLGEKGTQLSGGQKQRIAIARALIRKPKVLLLDEAT
SALDSQSEKVVQEALDKASFGRTCIVIAHRLSTVQDADVIVVINRGRDMEIGTHSELMSK
KGLYRHLYNLQGK
NT seq 3822 nt   +upstreamnt  +downstreamnt
atgaagaaaaaagaaaatggaatatcaacattatcttacgtaaatgaaagtttcatgcaa
gatggcgatgaaaaatttgataaagaaacaaagaatgatattattaatccgcaaaaacct
tttgatccacccataattagttttcataaattgtttaggtttgctgatccctttgaaata
tgccttatgttacttggagtggttggaagcatcatcactggattgagtgcaccaggcaac
acattaatatttggagaattaacggatgccttagtcaattttagtttgggaacaattgga
acagaagaatttttaggtaaagttcaccattctaaaaaggatttatgcattttagattcg
gttgatggtttcgtcataaataattcaataattggactcatattgttaacgattacattt
atatcgatatcactttttggttatgcaactcaaaggcagatttatagaattcgtaccaaa
tatttcaggtcggcattaagtcaagatattggatggtacgatataaacaacacgggagat
tttgccagcagaatgtccgaagatcttaacaaactagaagaaggtattagtgaaaaatgt
ttgcacgtcgttcattctctttcggcgtttgtaggttgtatcgtattagcgttacttaaa
ggttgggaacttgcactcattagtttatcatcacttcctgttatatcgattacaattgga
gtcatcggatttatttcttcaaggttatcaaaaaacgaacttgaagcttatgccaaagca
ggttctattgcagaagaagttttatcttcgataagaacggtcgtggcttttgacggttcg
aataaagaatcattgaggtacgaaaaatatcttttagaagcaaaacagaataatgttaaa
aggaaattttttaatggaatcagttttggagctttgtggtttttaatttatgcaacttat
ggttttgctttctggtttggagtttcatttgttttcgatggaaaatacagtcctggacaa
atgacaactgtattctttagcgttatggtcggttcgatgaattttggaataacaacacca
tacattgaagtttttgcatcggcaaaagctgcaggggctaaagttttttgggtgatcgat
cgaatatcatcgataaatcctaattctaacgaaggtcttaaaccggataaaatgaaagga
aatattgaatttaaagacgtcaaattttcatttccgtcacgaccgaacgttcctgttttg
aacgggatttctttgaaaataaacaacggagaaacggtggctttggtgggaagttctgga
tgtggaaaatctacttgtcttcaactcattcaacgcttctacgatccttctagtggatcg
gtgttggtggacgaagaggaagtgaaaaatttaaatgttaaatatttgagacaacatatt
ggagtcgtcggacaagagcccgtattatttgcaacttcaattaaagaaaacattcggtat
tccaatgaaaatgccaccatggatgatataatagcatcggctaaaatggctaacgctcat
aatttcatatctaaattgcctcagggttacgatactattgtgggagatagaggagctcaa
atgtcggggggacaaaagcaaaggattgccatagctcgagcattagtacgaaatccctgc
attttacttttggacgaagcaacgtccgctttggataatgcaagtgaagctaaagtgcaa
gcagctttagaaaaagcagccaaaggtagaactacgatcatcgttgctcatagactgtct
accattcgccaagctgataaaataatagtaatgtcaaaggggacaattgttgaagaagga
acgcacgatagtttgatagaaaaaaaaggtcactattttgatttagtcactgcacaaaga
caagcctttaacgaaaatgataaaaatgaaaaagaagaaattgaagaagattcaaaagat
atttatgatgcattcgatcgtaaagactctacggtaccttctaaaacggatgtacgtgtt
cttgttacggaaacggataaaccaaaagaaaagataactttgttcgaaataataaaatta
aacgctccagaatggaaaataataaccatcgcaacgttgagcagcatggcgataggattt
tgttctccatttttttccatcgttttcggtaatatcatgggagttttttccattccggat
aaagatcaagctctatcggaaacggtcagttattgtttgtattttgtcggtatcggagtt
ttaatgggtctgggaacttttatacaaatttgggcttacggaacggctggagaaatactt
accatgagattgagatatatgacgttttcagctatgctcaaacaggaaatgtcttggttc
gacgacaaatcgaattccgttggagctttgtgttcgagattatccggtgatacgagtaac
gttcaaggcgcgactggtcaacccatcggttccgttgttcaaggaattgcaacaataagt
ttggctttaagttttgcaatgtattttcaatggaaattaggtttcacaacgttagccttt
gcaccgtttttattcgccggaagttatttcatggcgagagtattgaaaggcgatgccaaa
ggaaatcaaaaaatattagaaaaatcaacagcgattgctatcgaagctgttggaaatatt
cgtaccgttgccagtttgggacgtgaaaattcattttataaagaatacgaaaacgaattg
ttgccatcgaataaaataatgacgcgcaattcacaaataaaaggcctaattatgggagtt
tcgagatctctcatgtttttcgcatatgccgcttgcatgttttacggcggaagattaatt
gcctacgaatccgtacattatcaagatgtattcaaagtaactcaaacaatgataatggca
agtttttcattggctaacgcgtttgcttttgcccccaattttcaaaaaggtttaacttcg
gccacgaatttgtttttatttttaagaagggaaccgaaaataaaaagtccagacgttact
cgagttgattcggaatgggaagctcaaggagaagtcaaatacgataacgtcagctttaga
tacccgtctagaccggatgctcaaatattaaaaaatttaaatttacaagtactcaaaggg
aaaaaagtggctttggtagggcaaagcggatgtggaaaatcaactttgatacaattattg
gaaagattatacgatccggacgagggagaagtgtttttagattccgaagagataaagaca
ttgaaactatctgcgttgagaaaacaattgggaatagtttcacaggaacccgttttattc
gacagaacgatttcagaaaatatcgcttatggtgataacgataggaaagttgaaatggat
gaaatcatcgaagccgcaaaacaagctaatattcacgattttatttcaaatcttccattg
ggatacgatacaagtctcggggagaaaggaactcaattgtcaggaggtcaaaaacaaagg
atagcaatcgcacgagcgttaattagaaagccaaaagttctcttgttggatgaagcgacg
tcggctctggatagtcaaagtgaaaaagtagttcaggaggccttagacaaagcgagcttt
ggacgcacgtgcatcgtaatagctcaccgattatcaacagttcaagatgctgacgtcatt
gtcgttatcaaccgtggaagagatatggaaatcgggacacattcggaattgatgtcgaaa
aagggattgtacaggcatctctacaacctacagggaaaatga

DBGET integrated database retrieval system