KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM584030
Entry
Phum_PHUM584030   CDS       T01223                                 
Name
(RefSeq) tyrosyl-tRNA synthetase, cytoplasmic, putative
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Phum_PHUM584030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phu01007]
    Phum_PHUM584030
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phu03016]
    Phum_PHUM584030
   03029 Mitochondrial biogenesis [BR:phu03029]
    Phum_PHUM584030
Enzymes [BR:phu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Phum_PHUM584030
Amino acid related enzymes [BR:phu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Phum_PHUM584030
Transfer RNA biogenesis [BR:phu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Phum_PHUM584030
 Prokaryotic type
    Phum_PHUM584030
Mitochondrial biogenesis [BR:phu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Phum_PHUM584030
SSDB
Motif
Pfam: tRNA-synt_1b tRNA_bind
Other DBs
NCBI-GeneID: 8232529
NCBI-ProteinID: XP_002432437
VectorBase: PHUM584030
UniProt: E0W243
AA seq 531 aa
MCGETGGKVPLSLEEKKNLITRNLQEVLGEEKMLEILKTRELKIYWGTATTGKPHIAYFV
PMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLSLRTTYYQQIITEMLKSINVPTEK
LKFVRGSDYQLSKEYTLDVYKLSTLITEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDE
EYLKIDAQFGGVDQRKIFTLAEKYLPQLGYTKRVHLMNCMVPGLTGAKMSSSEEDSKIDL
LDSPEAVKKKLKKAFCEPGNIEDNGVLAFVKHVIFPIFIQDGKFVVKRSEEHGGNMEFGS
FEAIQEAFASLQLHPGDLKLAVEGYINQLLAPIRKAFDTPELKKLTNSAYPAPTKNKSNK
QPAVEELTPARLDIRVGKIVEVSKHPDADSLYVEKIDVGDDEPRTVVSGLVNYISIEELK
NKLVVVLCNLKPVKMRGIESCGMVLCASKDEPKEVEILTPPEGSQGGDKIFVDGFTNGTP
DDVLNPKKKIWEKLQEDLKTNSVCEACWKDNQLLTKNGVIKCKTLKNTFIK
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgtggtgaaactggaggcaaagtgcctctcagtttagaagagaaaaaaaatttaatt
actagaaatcttcaagaagtattaggagaagaaaaaatgttagaaattttaaaaacgaga
gaattgaaaatatattggggaactgctacgacaggaaaacctcacattgcatattttgta
cccatgtctaaaattgcagattttctaaaagcaggatgtgaggtaactattctatttgct
gaccttcatgcatatttggacaatatgaaagcaccatgggagttattaagtctcagaaca
acatattatcaacaaatcattacagaaatgcttaaatctattaatgttcccactgaaaag
cttaaatttgttagaggatcagactatcagcttagcaaagaatacactcttgatgtttat
aaattatctaccttaataacggagcatgatgctaaaaaagctggagctgaagttgtgaaa
caagtcgaacatccattactatctggtttgctttatcccggactccaggctttagatgaa
gaatatcttaaaatagatgctcaatttggtggcgtcgatcaaaggaaaatttttactcta
gctgaaaaatatttgcctcaattaggatataccaaaagggtgcatctaatgaattgcatg
gtgccaggattaactggagccaaaatgtcttcgtcggaagaagatagtaaaatagatttg
ctggattctccggaagctgtaaaaaaaaaattaaaaaaagctttttgcgagcctggaaat
attgaggataatggcgttctagcttttgtcaaacatgttatttttccaatatttattcaa
gatggtaaatttgttgttaaaagatctgaagaacatggtggaaatatggaatttgggtct
tttgaagctatacaagaagcattcgcttcattgcaacttcatcccggtgatttgaaacta
gctgtggaaggttacattaatcaactgttagcccctataagaaaagctttcgatacacct
gaattaaaaaaattgacaaactctgcttatccagcacctaccaaaaataaaagcaacaaa
caaccagctgtcgaagaattaactcctgcaagattagatattagagttggaaaaattgta
gaagtttcaaagcatccagatgctgattctttatacgttgaaaaaatagatgtgggagat
gatgagcctagaactgttgtaagtggactcgttaattatatatccatagaagaactgaaa
aataaattagttgtcgtactttgtaatttaaaacctgttaaaatgagaggaatcgaatca
tgtggtatggttttgtgtgcgtccaaagatgaacctaaagaagttgaaattttgactcct
cctgaaggtagccaaggtggcgataaaatttttgtcgatggatttacaaacggaactcca
gatgatgtattaaatcccaaaaaaaaaatatgggaaaagcttcaggaagacttgaaaacg
aattcagtttgcgaagcatgttggaaagacaatcaattgttaaccaaaaatggagttatc
aaatgcaaaacattgaaaaatacatttattaaataa

DBGET integrated database retrieval system