KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM598510
Entry
Phum_PHUM598510   CDS       T01223                                 

Name
(RefSeq) vacuolar ATP synthase subunit E, putative
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00190  Oxidative phosphorylation
phu01100  Metabolic pathways
phu04145  Phagosome
phu04150  mTOR signaling pathway
Module
phu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Phum_PHUM598510
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    Phum_PHUM598510
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Phum_PHUM598510
SSDB
Motif
Pfam: vATP-synt_E HrpE DUF4288 Folliculin
Other DBs
NCBI-GeneID: 8236854
NCBI-ProteinID: XP_002432718
VectorBase: PHUM598510
UniProt: E0W2X4
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKK
EKQVELQKKIQSSNMLNQARLKVLKVREDHVRNVLDDARRHLGEITKDANRYGKLLESLI
VQALLQLMEPAVTIKVRQQDEALVSSILPNCVSQYKEKIKKDVTLKIDKDNCLPADTCGG
IELQAQRDRIKISNTLESRLELIAQQLLPEIRSALFGRNPNRKFAD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgcttagcgatgcagatgttcaaaaacagattaaacatatgatggcctttattgag
caagaggcaaatgaaaaagcagaagaaatagatgctaaagctgaagaagaattcaatatt
gaaaagggaagattggtccaacagcaaaggctcaagatcatggaatactatgaaaagaaa
gaaaaacaagttgaattgcaaaaaaaaattcaatcatccaacatgttaaatcaagctcgt
ttgaaagttttaaaagttcgtgaagatcatgtaagaaatgttttagatgatgctcgtcgt
catttgggtgaaattacaaaagatgctaatcgttatggaaaacttcttgaaagtcttatt
gttcaagcattgttacagcttatggaacctgctgttactattaaagtgagacaacaagat
gaagctcttgtttcgagtattcttccaaattgcgtttctcaatacaaagaaaaaataaaa
aaagatgttacattgaaaatagataaagataattgtttaccagctgatacctgtggtgga
attgaacttcaagcgcaaagagatagaattaaaatatcaaacactttggaatcaagatta
gaactcatagcacaacaattacttccagaaattcgttctgctttgtttggtcgcaatcca
aacagaaaatttgcagattaa

DBGET integrated database retrieval system