KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM617010
Entry
Phum_PHUM617010   CDS       T01223                                 
Name
(RefSeq) Trehalase precursor, putative
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00500  Starch and sucrose metabolism
phu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Phum_PHUM617010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phu00537]
    Phum_PHUM617010
Enzymes [BR:phu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     Phum_PHUM617010
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phu00537]
 Enzymes
  Phum_PHUM617010
SSDB
Motif
Pfam: Trehalase Mab-21_C
Other DBs
NCBI-GeneID: 8239863
NCBI-ProteinID: XP_002433202
VectorBase: PHUM617010
UniProt: E0W4A8
AA seq 609 aa
MFVLKTKTPTAVACSNCFQLFKILKRNQSSEVQPCFHQNHHLTSSDPTTKCNVPIPTNSE
IYCHGRLLHTIQMAQLYNDSKTFVDKKLKYKPAVTLEKFNVLMQETEDRPTRKQLQDFVN
DYFEDGNELEAWTPPDWTPHPQFVDNIIDPNYRKWALDLNNLWTNLTRKMIVDVKNNPDQ
YSIVYVPNGLVIPGGRFTEFYYWDTYWIVRGLLLSEMYETVRGILLNFLSMVSQYGFVPN
GGRVYYLERSQPPLLTPMVLSYYEATNDIDFLQSHICLLEKEFNFWVKNRTVEVYKGGKK
YKLARYFAPSSGPRPESYSEDYNSAAFLPTQLEKEDLYMDLKSAAESGWDFSSRWFITNK
TNQGNISSIHTRYIIPVDLNAFIYWNAKILSQFYEILQNYEKSVQYSEIAEYWLEAVTAV
LWHSDLGIWLDYDIRNNIRRDYFYPSNLAPLWTECYDKKSVNKVARSVIQYLDDSNIMVN
FLGGLPASLEMTGQQWDRPNAWPPLQIIAIQGLNRMNVPEASDIAKELAKNWVYSNFKGF
HDSNEMFEKYDAENPGRYGSGGEYIVQAGFGWTNGVIMELLNTYGKELQCSDKDICDLTE
PIKQNGLDK
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgtttgtacttaaaacgaaaacgccgacggcggttgcttgttcgaattgttttcaatta
tttaaaattctcaaaagaaatcaatcgtccgaggttcaaccttgttttcatcaaaatcat
catttaacatcatccgatccgactactaagtgtaacgtaccgattcctaccaacagcgaa
atatactgtcatggcagacttttgcacacgatacaaatggctcaactttacaacgattcg
aaaacgttcgtcgataaaaaattaaaatataaacccgccgtgacgttggaaaaatttaac
gttctcatgcaggaaacggaagatcgtccaacgagaaaacaactacaagattttgtcaac
gactatttcgaagatggtaacgaattagaagcttggaccccacccgattggactcctcat
ccgcaattcgtagataatataattgatcctaattatagaaaatgggctttagatctcaat
aacttatggactaatttaacgagaaaaatgatagtagacgtaaaaaataatccggatcaa
tattcgatcgtttacgtacccaatggactcgtcatacctgggggccgttttaccgaattt
tactattgggacacgtattggatagtgaggggtcttttacttagcgaaatgtacgaaacc
gttagaggtatactactcaattttctaagcatggttagtcaatatggtttcgtaccgaac
ggaggaagggtatactatttggaaagatctcaaccgccgcttttgacacccatggtttta
agttattacgaagcaacgaatgacattgatttccttcagagtcacatttgccttttagaa
aaagaatttaatttttgggtcaagaatagaacggtggaagtttacaaagggggtaaaaaa
tacaaattagcaaggtattttgcaccttcgagtggtcccagaccggaatcttacagcgag
gattacaacagcgcagcatttttacccactcagttagaaaaagaagatctttacatggat
ttaaaatcggcagccgaatctggttgggatttcagcagcaggtggttcataactaataaa
acaaatcaaggtaacataagtagtattcacacccggtacataatacccgtggatttgaac
gcattcatttattggaacgcaaaaatactctcccagttttatgaaatcctacaaaattat
gaaaaatccgttcagtattccgaaatagccgagtattggttagaagcagtcacggccgtg
ctatggcattccgatttaggcatttggttagactacgatataagaaacaacattagaagg
gattatttttatccatcgaatttagcacccttgtggacggaatgctatgataaaaaatct
gtaaataaagtcgcacgttcggttatacaatatttagacgattcaaacattatggttaat
ttcttaggtggattaccggcatctttggaaatgaccggacaacagtgggatcgtccgaac
gcttggcctccgttacaaatcatagccatacagggtttgaatagaatgaacgttccggaa
gcgagcgacatagccaaagaattagctaaaaattgggtttattcaaatttcaagggattc
catgacagtaatgaaatgtttgaaaagtacgacgctgaaaatcccggcaggtacgggagc
ggaggggaatacatcgtacaggctggattcggttggacgaacggagtcattatggaactt
ttaaacacttacggaaaagaattgcaatgttcggacaaggatatttgcgatttaacggaa
cccataaaacaaaacggactcgataaatga

DBGET integrated database retrieval system