KEGG   Pseudothermotoga hypogea: AJ81_04180Help
Entry
AJ81_04180        CDS       T04277                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
phy  Pseudothermotoga hypogea
Pathway
phy00260  Glycine, serine and threonine metabolism
phy01100  Metabolic pathways
phy01110  Biosynthesis of secondary metabolites
phy01120  Microbial metabolism in diverse environments
phy01130  Biosynthesis of antibiotics
phy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AJ81_04180
Enzymes [BR:phy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AJ81_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 Thump_like ComA
Motif
Other DBs
NCBI-ProteinID: AJC73535
UniProt: A0A0X1KQE8
Position
813488..814519
Genome map
AA seq 343 aa AA seqDB search
MDLRSDTVTKPTAEMRKAIAEAEVGDDVYGEDPTVNRLEELAAEMFGKEAALFVASGTMG
NQVSIMAHTQRGDEVILEADSHIFWYEAGAMAVLSGVMPHPIKGRNGAMDPDEVRRAIRP
KDIHFPRTSLISIENTHNRSGGRVVPIENFKAIYEIAKEHGINVHVDGARIFNAAIASNV
SVKEYAKYADSLMFCLSKGLCAPVGSIVVGSKQFIERARKARKILGGGMRQAGVLAAAGI
VALTKMVDRLKQDHENAKFLALKLREIGYMVNPEEVETNMVILRTDNLRVDAHQLLKTMK
ERGVLAVAFSDSSIRLVTHNDVSRSDILRALDVFEKLFKEFRL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atcgatcttcgttcagacactgtaacgaagccaacggccgagatgagaaaagccatagcg
gaggcagaagttggagacgatgtgtacggggaagatcccacggtgaacagactcgaagag
ctggccgcagagatgttcggcaaggaagcggctcttttcgttgcatccggaactatgggc
aatcaggtcagcatcatggcacacacccagcgcggtgatgaagtgatactcgaagcggac
agccacatcttctggtacgaagcaggcgcaatggccgttctttcaggcgtgatgcctcac
ccaatcaaaggtagaaacggcgcgatggatccagacgaggttcgcagagcgataagaccc
aaggacatacactttccgagaacttccttgataagcatagagaacacccacaacaggtcg
ggtggtagagtggttcccatcgaaaacttcaaagcgatctacgagatcgccaaggagcat
ggaataaacgtccacgtcgatggtgcgaggattttcaacgccgcgatcgcttcgaacgtt
tcagtcaaagagtacgccaagtacgcagactctctgatgttctgcctttccaaaggtctc
tgtgcacccgtcgggtcgatcgtggtggggagcaaacagttcatagaaagggcaagaaag
gcgaggaaaatactcggaggtggtatgaggcaggcgggtgttttagctgcggccgggatc
gtcgctttgaccaagatggttgaccgattgaagcaagaccatgaaaacgcaaaattcctt
gcactgaaactgagagagattggctatatggtcaacccagaggaagtcgaaaccaacatg
gtgatcctgaggacagacaatttgagagtcgacgcacaccagctattgaaaacgatgaaa
gaaagaggcgtcctcgccgtcgctttctcagactcgtcgatacggctcgtgacgcacaac
gacgtttcgaggagcgatatactgagagcgttagacgtgtttgaaaagttgttcaaagaa
ttcagactttga

DBGET integrated database retrieval system