KEGG   Pseudothermotoga hypogea: AJ81_08010Help
Entry
AJ81_08010        CDS       T04277                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
phy  Pseudothermotoga hypogea
Brite
KEGG Orthology (KO) [BR:phy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AJ81_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJC74125
UniProt: A0A0X1KS35
Position
complement(1599910..1600833)
Genome map
AA seq 307 aa AA seqDB search
MLYVLSAIFLGWILGANNTASIFGPGIASGVFSHRKVALIGSVFVVLGALINGSEGLKNL
SSLGSNYAYDGAIVLLCAGLTMLALTRLGFPASATQTVFGGMVGAGLVRVGVASMNWHIV
ARFLLSWVLTPLFAALTAFFIYHVLAFFFRKIHRTQFQDIFVYIASWLAGLYDAYALGAN
NVANVTGPVLIHLSSLELAALLGGSSIALGVIFSSRKVIDTVGKQIVALDHFSSLVAMLA
QATTLFTFSFVGIPVAASQAIVGGVIGAGYARGIKLSSWKTVLSMMSAWLLAPLASGVLS
AFVCRFF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacgtgctctcggcaatttttctgggttggatcctcggcgcgaacaacacagcg
tccatctttgggcctggtatcgcatcgggtgttttcagccatagaaaagttgcgttgatt
ggctctgttttcgtcgtgctcggcgcactgatcaatggaagcgaggggttgaaaaatctt
tcctcgctgggttcaaactatgcgtatgatggtgcgatagtgcttttgtgtgcgggatta
accatgcttgcactgacaagacttggtttcccggcctcggccacccagactgtctttggc
ggtatggtcggagcaggactggtacgtgtaggagtcgcaagtatgaactggcacatagtt
gcacgattcctgctgtcttgggtcttgacgcccctttttgccgctctgactgcctttttc
atctatcacgtgctcgcgttctttttcagaaaaattcaccgaactcagtttcaagacata
ttcgtttacatcgcttcgtggctcgcagggctgtacgatgcgtacgcgctgggtgccaac
aacgttgcgaacgtcacgggtccggtgctgattcatctctcttccttagagctggccgca
ttgctcggtggttcttccatcgccttaggtgtcattttcagcagtaggaaggtcatagac
acggttggaaaacagatcgttgcactcgatcatttctcatcgctcgttgcgatgctcgct
caggccaccactctctttaccttcagttttgtcgggatacccgttgcggcttcgcaagcc
atcgtgggtggggtgataggagcaggttatgcaagaggtatcaagctttcgagttggaaa
accgtgctgtcaatgatgagtgcgtggctgttggcccccttagcttctggtgtgctctcg
gcattcgtgtgtagattcttctga

DBGET integrated database retrieval system